KEGG   Poecilia reticulata (guppy): 103475408Help
Entry
103475408         CDS       T05149                                 

Gene name
dpp3
Definition
(RefSeq) dipeptidyl peptidase 3
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pret01002]
    103475408 (dpp3)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     103475408 (dpp3)
Peptidases and inhibitors [BR:pret01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   103475408 (dpp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 103475408
NCBI-ProteinID: XP_017163979
Position
LG14
AA seq 684 aa AA seqDB search
MVDSQYYLPNDIGISALDCREAFRLLSPQEKMYAHYLSRAAWYGGLVVLLQTSPESANIF
VLLQKIFRKQTPDQLEQVAKAAGVSSEDYQAFLVYAAGVYANMGNYKSFGDTKFIPNLPK
DKLEALVRASQAFQENPTEMEALWGSSSCLIYSLEDRQKQLGLGDKGITTYFSGNCXLED
AELAQRFLDSRKLSAYNTRLFKRENGGKSCYEVRLASAVQKDCAVDGEAGSSCGSFTFED
KEFMVKRGDYSPLMEKVCHYLQEAQAYAANDNQKKMLEEYRRSFEFGSIEAHKEGSRFWI
KDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSERFARLVSSAEVLLPELPWPQ
QFEKDNFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQSEGFKNVSLGNVLAVAYATQK
EKLTFLEEKDKDLFIKWKGPSFEVQVGLHELLGHGSGKLFVQDDRGKFNFDQSNVVNPET
GEKVSSWYRGSETWDSKFSTIASSYEECRAECVGLYLCLNKQVLSIFGHEAQEAEDVVYI
NWLSMVRAGLLGLEFYTHESKSWRQYFQVFKSTADVEGGRALYEGYSTVSDTGTHNFLRL
RETVLLRKEARKMFVQANTRISGNKLEFGDRHMNQTGGENVELVEYESSAAGLIRSFTER
FQDDAEQLEAVLLDLNKTDARYWC
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggtggactctcagtactacctccccaatgacattgggatctcagcgcttgactgccgc
gaggcctttcgtctgctgtcacctcaggagaagatgtacgcccactacctgtcacgggcc
gcttggtatggtggtctggtggtgctgctgcagacctctccagagtctgcaaacatcttt
gtcctgctgcagaagatttttaggaagcagactccggatcagctggagcaggtggctaaa
gcagctggtgtcagctctgaggattaccaggccttcttggtgtatgctgctggtgtatat
gcaaacatgggcaactacaagtcttttggagacaccaaattcattccaaatctaccaaag
gacaagctggaggctctggtgagggccagccaagcgtttcaggagaatcccactgagatg
gaggctctgtggggcagcagctcatgcctcatttactccctggaagacagacagaaacaa
cttgggctgggcgataagggaattaccacttatttctcaggaaaytgcwgtctggaggat
gcggagctrgctcaamgatttctggactcaagaaaactctctgcttacaacacacgtctg
ttcaagagggaaaatggaggaaaatcctgctatgaggttcgcttggcttcagctgttcaa
aaagactgtgcagtggatggggaggctgggtcgtcctgcggcagcttcacctttgaggac
aaagagttcatggttaagaggggagactacagtcctctcatggaaaaagtctgccattat
ctccaagaagcccaggcgtatgctgctaatgacaaccagaagaagatgctggaagagtac
cggcgcagttttgaatttggttctattgaagcccacaaagaaggctcccggttttggatc
aaggacaaagggccgattgttgagagctatataggtttcatagagagctacagagacccc
tttggctcccgaggagagtttgaaggatttgtggccgttgtgaacaaggcgatgagtgag
cgttttgccaggctggtgagctcagcagaagtcctgcttcctgagctgccctggccccag
cagtttgagaaggacaacttccttaaacccgacttcacttccctggatgttctcacgttt
gccggcagtggaattccagccgggattaacatcccaaactatgatgacatcaggcaatcg
gaaggctttaaaaacgtgtctcttgggaatgtgctggcggtggcctacgccacacagaag
gaaaaactcacattccttgaagagaaggacaaggatttgttcatcaaatggaagggtccg
tcctttgaggtgcaggttggtctccatgagctcctgggtcatggaagtggcaagctattt
gtccaggatgaccgtggcaagttcaacttcgaccagagtaacgtggttaayccagagacr
ggggaaaaggtgtccagttggtatcggggcagcgaaacgtgggacagtaaattctccacg
attgcgtcttcctatgaagaatgcagagctgaatgtgttggcctctatctgtgcctgaac
aagcaagtgctgagtatttttggccatgaggctcaggaggctgaggatgtggtgtacatc
aactggctgagcatggtcagagctgggctgttgggtctggagttctacacgcatgagagc
aagagctggagacagtattttcaggtgtttaagtcaaccgctgacgtggaaggaggcaga
gctctctacgagggttactccactgtcagcgacaccggcactcacaacttcctgcgtctg
cgtgagaccgtgctgcttcgcaaagaagctcgcaaaatgtttgttcaggccaacaccaga
atcagtggcaataagctggagtttggtgacagacacatgaatcagactggaggggagaac
gtggagctggtggaatatgaaagcagtgctgcaggtttgattcgctccttcaccgaacgc
ttccaagacgacgcggagcagctggaagccgtccttttggatctgaacaaaactgacgcc
cgttactggtgttga

DBGET integrated database retrieval system