KEGG   Poecilia reticulata (guppy): 103476010
Entry
103476010         CDS       T05149                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00100  Steroid biosynthesis
pret01100  Metabolic pathways
Module
pret_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103476010 (tm7sf2)
Enzymes [BR:pret01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103476010 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103476010
NCBI-ProteinID: XP_008426253
Position
LG14
AA seq 474 aa
MTTDKSDWLRGGSMPTGRTLGGSMCRLQCGRIGQPQAQQTPSFTQHWRRKMGPKKSPKHR
LSHDTEREFGGTLGAVCIPVFLPLTVLFLICVSQSVEASVLQWPPCLPSADQLWDPLAPT
LLLGWIGLQALLYLLPLGKVSEGLALRDGSRLKYPINGFHGLCISAVLLSVLLALGAPLG
YLFELLAPLAVSAIAVSFLSSVYLYVRSFWAPSLALALGGDTGNPLYDFFIGRELNPRIG
NFDLKYFCELRPGLIGWVVLNLGMLMKEAELRGSPSLSMILVNCFQLLYVADALWNEEAV
LTTMDIVHDGFGFMLVFGDLAWVPFTYSLQASFLVAHPQSLSSLTAAAIVALNGAGYYIF
RKSNSQKNQFRRDPTHPSVSGLETIATATGKRLLVSGWWGLVRHPNYLGDLLMALAWSLP
CGFSHLLPYFYVVYFTVLLVHREARDERQCRAKYGLXWDAYCRRVPYRIFPYIY
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaccacggacaaatctgattggctgagagggggctccatgccgacaggtcgtactttg
ggcggatccatgtgcaggttgcagtgtggacggataggacagcctcaggctcagcagact
ccctcattcacccaacactggaggagaaaaatgggaccyaagaaatccccgaaacacaga
ctgtcacacgacacagagagagagtttggaggaactctgggcgccgtgtgcatcccygtt
ttcctcccactgaccgttctcttcctgatctgtgtgagccaatcagtggaggccagcgtc
ctgcagtggcccccctgcctcccstccgccgaccagctgtgggacccgctggctcccact
ctgctgctgggatggatcggactgcaggccctcctctacttgctgccgttagggaaggtt
tccgaaggattagcgttgagggacggaagccgcctcaagtatcccataaatggtttccac
ggcctgtgcatcagcgccgtgttgctgtcggtgctgctggcgctcggcgctcctcttgga
tatctctttgagctgctggcgccgctggcggtgtctgccatcgccgtgtcgttcctgtcc
tccgtctacctctacgtccgctccttctgggccccctcccttgctctggccctgggggga
gacacagggaatcccctctatgacttcttcattgggcgggagctgaaccctcggatcggg
aactttgacctcaagtatttctgtgaactcagaccaggtctgattggttgggtggtcctt
aacctcgggatgctgatgaaggaggcggagcttcgtggttctccttccctctccatgatc
ctggtcaactgtttccagctgctttatgtggcagacgctttatggaacgaggaggccgtt
ctgaccacaatggacattgtgcatgacggcttcgggttcatgctggtgtttggcgacctg
gcctgggttcccttcacctacagcctgcaggcttccttcctggttgctcaccctcagagc
ctgtcttcgctcacggcggcggccatagttgccctgaatggtgctgggtattacattttc
aggaaatccaactcgcagaagaaccagttcaggcgagacccgactcaccccagcgtttca
ggactggagaccatcgccacagcaacggggaaacggctgctggtgtcaggctggtggggt
ctcgttcgtcatcccaattacctcggcgacctccttatggcgctggcgtggtccctgcca
tgcggcttctctcacctcttgccgtacttctacgtggtttacttcaccgtcctgctggtt
caccgggaggcccgggacgagaggcagtgcagggccaagtacggactcgygtgggacgcc
tactgtcgccgagtcccctacaggatcttcccgtacatttactga

DBGET integrated database retrieval system