KEGG   Poecilia reticulata (guppy): 103476104Help
Entry
103476104         CDS       T05149                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1H-like isoform X1
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04010  MAPK signaling pathway
pret04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103476104
   04020 Calcium signaling pathway
    103476104
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pret04040]
    103476104
Ion channels [BR:pret04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103476104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 103476104
NCBI-ProteinID: XP_008426421
Position
LG14
AA seq 1329 aa AA seqDB search
MAETDDQLMTQCNATVITALPENREPTSAVEEPSGTTFHRFSIKFLFSHWPGYLALLVIG
FGCLIHGIYQPCTADHLPQKIASRVMLAYFFGELVIRVEALGIQEYFSYNWHRFDIFIIC
VELVDFILELCEIHLSLSYSVSPLRLLSRIEEMRKLVTMLVGILPMLGNVIJLYILVIYI
FAIVGVQLWAGDLLYRCFLPDEMLAMYSNLTPSYGSVPGERFPFICTLDKGMRFCKDIPA
SREGNLICTLPAPHLDPLASTHNGSQCVNWNAYYNTCRIGGENPNLNSINFDNIGYSWIA
VFQSVTLEGWSDIMYYVMDAHSWWSFVYFVVLTILGSYVIMNTCAVVIATHYSDAMKHEP
ERRFPGTVSFRAVWQGIKARISKLVSRVSSMCAHHHHHINESSPLGRCWLPIRRKLEMLV
TGTYFNRFITGAILLNILTMAIEHHEQPEMLTDVLKISNFAFTGLFALEMILKLVALGLD
YFQDWSNNFDCLIVIISMWELQAESDSRLSVMRAFRALRFGRLVHFLPYLYRQLMVLKRT
IEEAAMLCWLLFFIIFLFSVVGMHMFGCLIKGDLRESGSKSFDKIDARKNFDDLIWAMVT
VFQVLTLEDWNFVLYNCMASTSPWTAVFFVMMIIVGKNVILNILVGIVVENFQNQPEDHA
TLSGIPSTIGRRATLASQLDQLNAESSSAQMQQLQVEEAGAVPTEQELQALGWKRWFKEH
EDWSFYVFSPQNRWRIFCDKLVSHRHFKTGIQLVILLNCITIAFERPTIPPDSKERFYLD
KANDAFSAIFLLEMLLKMMAKGLIIGKTTYCHSPWNNLDGFLVVMSVIDIAILLGTEEGS
SRPLAILKILRLLRALRPLRMIERTPQLRLAVEALLASVKPMGNIIIVCGIFFFFYGILG
VQLFKGKFFYCHGSNVSMIVNKSDCLSSNYEWLLKEYNFDNLVSALISVFVMYSKDGWVE
LMYDGLDAVGVDQQPIPNYNLWMLLYFISFILMSFILLDMFIGVMVETFHKCQREQRIAH
KSKKRPHSVAEDEGFFLHYSKTRRKIHTVCSSPALEYSITTCVFLSMFVMGTEHFQQPKY
ISVLLEWVFYILTLLLIIEIVMKLIAFGIVRYLKDSWNMLDIFVVLISLVSVILGQLKFQ
EKMPINMGIFRVVRVLRLAQVLKTTKIKVLLKTIIRTLSQVGNIGLLFLFFFFIYAALGV
ELFGSIECSIDFPCLGLHRLSDFNNFMVALLTLYKVSTGDNWSGILKDTMPGCLPNDDNC
NPYLNYASPIFFTSFVITVQFVLVNLVVAVIMQALDDSRKEGNGETRMRNIVLLNEPSVP
DEIFGEESN
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaccgatgaccaactgatgacccagtgcaatgcaacagtcatcacagcatta
ccagaaaacagggagcccacatcggccgtggaagagccaagtggcacaaccttccatcgg
ttctccattaagtttctctttagccattggccaggctatctggctcttttggtcataggg
tttggctgtcttattcatggaatttaccagccttgcacagcagaccatctccctcaaaag
attgcatcccgcgtgatgctcgcctacttctttggggagctggtaatcagagtggaggct
ctgggcatccaggaatacttttcatacaactggcacagattcgacatctttattatttgt
gtagagcttgtagacttcattcttgaactttgtgagatacacctatcactctcctattca
gtttccccattgcgactgttaagcaggattgaagagatgcgcaagttggtgaccatgctt
gtggggatcctgcccatgctgggaaatgtaatcwtactctatatactcgtcatatacatc
tttgccattgtgggagtccagctgtgggcgggggacctgctttaccgctgctttttgcca
gatgagatgcttgcaatgtacagcaacttaactccgagctatgggtctgtccctggcgaa
agatttcccttcatctgtaccctcgacaaaggcatgcggttctgtaaagacatacctgcc
agtcgtgaaggcaatctcatctgcacgttacccgctccccacctggatccacttgcttcg
acccataacggtagtcagtgtgttaactggaacgcatactacaacacatgtcgtattggt
ggagaaaacccgaacttgaactctataaactttgacaacatcggctactcctggattgcc
gtttttcagtctgtcacactggaaggctggtctgacataatgtactatgtgatggacgca
cactcctggtggagttttgtgtatttcgtcgtcctcacaattctcggctcctacgtcata
atgaacacatgtgccgttgttattgccacccactactcagatgccatgaaacatgagcct
gaaaggaggtttcctggaaccgtgagcttccgtgcagtttggcagggtataaaggcaagg
atttcaaaactcgtctcaagagtgagtagcatgtgcgcccatcatcatcaccacataaac
gaatcatcaccactgggccggtgctggctgcctatccgtaggaagctagagatgctcgtg
acagggacttacttcaacaggtttatcacaggtgctattctgctcaacatcctaaccatg
gccatcgagcaccatgaacagcctgagatgttgacggatgtattaaagatctctaacttt
gccttcacgggtctgtttgccctggagatgatcctgaaactggtggccttggggcttgac
tactttcaggactggagcaacaactttgactgtctcatagttatcattagtatgtgggaa
ttgcaagctgaaagtgacagcaggctgtcggtcatgcgcgcatttcgagccctgcggttc
gggaggcttgtgcatttcctcccttacctgtacagacaactgatggtcctgaagaggacc
attgaggaggccgccatgctctgctggctgctgttcttcattatcttcctcttcagcgtc
gtgggaatgcacatgttcggctgcctaattaagggagacctacgtgaatccggcagcaaa
agcttcgacaagattgacgcgcggaaaaactttgacgacctcatttgggccatggtcaca
gtgttccaggttctgacgttagaagattggaactttgtcctttacaactgcatggcctcc
acctcaccatggactgccgtgtttttcgtgatgatgattattgtggggaagaacgtgatt
ctcaacatcttggtggggattgttgttgagaacttccagaaccagcccgaagatcacgca
acactttcaggaattccttcgaccattggccgtcgcgccactttagcttcccaacttgac
caactgaacgctgagtccagctctgctcagatgcagcagcttcaagtggaagaagctgga
gctgtcccgactgagcaggaactgcaagctctaggctggaagcgctggttcaaagagcac
gaagattggtccttctatgtgttttctccacagaataggtggcgtatattttgcgacaaa
ctggtgtcccacaggcatttcaaaacggggattcagctcgtcatcttgctgaactgcatt
actattgcttttgagaggcctaccatcccgcctgatagcaaggaacgattttacttggat
aaagccaatgacgccttctccgccatttttctcctggaaatgctactgaagatgatggca
aaaggactgatcattgggaaaaccacctattgccacagtccctggaacaacttggacggc
tttctggtagtcatgtctgtaatagacatcgccatcctactggggacggaggagggatcc
tccagacctctggccatccttaaaatactgcgtctgctacgtgcgctccgtcccctcagg
atgattgaacggaccccccaactgagactggccgtggaggcgctgttagcttctgttaag
cccatgggaaacatcattattgtttgcggcattttctttttcttttacggcatcctggga
gtgcagctgttcaagggaaagttcttttactgccatggttccaatgtatcgatgattgtc
aacaagtcggactgtctctcgtccaattacgaatggttgcttaaggagtacaactttgac
aacctggtttcggctctgatatcagtgtttgtcatgtactccaaggacggctgggttgaa
ctgatgtatgatggacttgatgctgttggagtggaccagcagcctattcccaactacaac
ctgtggatgcttctctacttcatctcgttcatcctgatgagctttatattgctcgacatg
ttcattggggtgatggtggagacgttccacaaatgccaacgggagcagcggatagctcat
aaatccaagaaaaggccgcactctgtggccgaagatgagggatttttccttcattattcc
aaaacacgtcgaaaaatacataccgtgtgtagcagtcctgctctggaatactccattacg
acctgcgtcttcctcagcatgtttgtgatgggaacagaacacttccagcagcctaagtat
atatcagttcttttagagtgggtcttctacatcttaaccctcttgctgatcattgaaatc
gtgatgaagctcatcgcatttggcattgtgaggtacctgaaagacagctggaacatgctg
gacatttttgtcgtcctgatttctctagtcagcgttattttgggccagttgaagttccag
gagaagatgccaatcaatatgggcatcttccgtgtggtgagagtcctcagacttgcacaa
gttctcaagaccacaaagatcaaagttttgctcaaaaccatcatcaggactctgtcgcag
gtcggaaatatcggtctcttgttcctgtttttcttcttcatctatgctgcgcttggagta
gagctctttggcagcatcgaatgctccatagacttcccttgccttggcctgcaccgcctc
agcgacttcaacaacttcatggtggccttactgacgctgtacaaagtcagcacaggagat
aactggagcggcatcctgaaggacacgatgccagggtgcttgcctaatgacgacaactgt
aacccctacctgaactatgcttctcccatcttcttcacctccttcgtcatcacrgtccag
tttgttctcgtgaacttggtggtggcagtaatcatgcaggcgctggatgacagcaggaag
gaaggaaatggggaaacacggatgagaaatattgtacttctcaacgaaccttcggtgccc
gatgaaatcttcggggaggaaagcaactaa

DBGET integrated database retrieval system