KEGG   Poecilia reticulata (guppy): 103476795Help
Entry
103476795         CDS       T05149                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00562  Inositol phosphate metabolism
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103476795
   00562 Inositol phosphate metabolism
    103476795
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103476795
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103476795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103476795
NCBI-ProteinID: XP_008427606
Position
LG15
AA seq 462 aa AA seqDB search
MTSFLCKIFFFTAITGSSWCFRNDSSPEENPNIPVIAKYFGTKGRYEEVNPYLIRDILAV
NRSSLQPPSPQCREIHLTAIIRHGTRYPTSKNVKKMEKLYKLVQSSARGKDRWLHEILTQ
WTMWYTEDMDGRLVQKGVEDLKHLAVRLSKLFPTIISEEKLRGGLIKFITSSKHRCVNST
LSFKAGLTEMWAITDVEFQHAVNDALMRFFDKCTKFVQEVDNNPSALTEMDKFTQGPEMV
RVQQKIADRLNVSYHLITYDMVEAAFYLCAYEFAIKTENSPWCRLFDEIDGQVMEYALDL
KQFWKRGYGYDINSKSSCILFHDVFSRLDKAVNEHHSGQAVNEAVTVQVGHAETLLPLLT
LLGFFKDSETLTSTNYASQRERSFRTSRMLPYAANLVLVLFDCGGRDIRLQPLVNEQPVV
FPGLADQQESMPLYEDIKRQYAELLNGCDYETVCELFKPAEP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgagctttctatgcaaaatcttcttctttaccgccataactggctcttcctggtgt
tttcgtaacgactcgagtccagaggaaaacccaaacataccggtcatcgccaagtatttc
ggcacgaaaggaaggtacgaggaagtgaacccttacctgatacgggacatactcgctgta
aacaggtctagtttgcagcctccatccccgcaatgtcgcgaaatccatctcacggccatc
ataagacacgggacgcggtacccgacgagcaaaaacgtgaagaagatggagaaactttac
aagctggtccagagcagcgcccgcgggaaagaccgctggttgcacgagattctgacccag
tggacgatgtggtacactgaggacatggacggccgactggtccagaaaggtgtggaggat
ctgaagcatctggccgtcaggctgtcaaagctcttcccgacaatcatctctgaggagaaa
cttagaggtggactcatcaagttcataaccagctccaagcacagatgtgtgaacagcacg
ctgtccttcaaagcagggctgacggagatgtgggccatcacagatgtggagtttcaacat
gcagtgaacgatgctctcatgaggttctttgacaagtgcaccaagtttgtgcaggaagtt
gataacaacccgtcagctttgacagagatggacaagttcacacagggacctgagatggtg
agggtccagcagaagatcgctgaccgtctgaatgtctcttatcatctcatcacatatgat
atggtggaggctgccttctacctgtgtgcttatgagtttgccatcaagacagagaactcc
ccgtggtgccgcctcttcgacgagatcgatggacaggttatggagtatgcactcgatctg
aagcagttttggaaaagaggctatggatacgacatcaacagcaaatcgagctgcattctg
ttccacgacgtgttcagtcgtctggacaaagccgttaatgagcaccattctggtcaggcg
gtgaacgaagccgtgacggtgcaggtcggacacgcagagaccctcctgcccctcctcacc
ctcctgggcttcttcaaggacagcgaaaccctgacgtccaccaactacgcctcacagaga
gagcgctccttccgcaccagtcgcatgttaccgtatgctgctaatttggtcctggttctg
ttcgactgcggaggacgggacatcagactgcagcctctggtcaacgagcagccggtcgtc
ttcccaggcctggctgaccagcaggagtccatgccgctctatgaggacatcaaaagacag
tatgcggagctgcttaacggctgtgactatgagactgtgtgtgagcttttcaaaccagct
gagccttaa

DBGET integrated database retrieval system