KEGG   Poecilia reticulata (guppy): 103477117Help
Entry
103477117         CDS       T05149                                 

Gene name
pcbd1
Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase isoform X1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00790  Folate biosynthesis
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103477117 (pcbd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103477117 (pcbd1)
Enzymes [BR:pret01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     103477117 (pcbd1)
Exosome [BR:pret04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103477117 (pcbd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 103477117
NCBI-ProteinID: XP_008428253
UniProt: A0A3P9N0Y6
Position
LG15
AA seq 123 aa AA seqDB search
MSVFWAEMSTSPFCPSCPATLQAGKIQTLSDEERAHLLPLLRNAQWVEAVGRDAIYKEFI
FKDFNQAFGFMSRVALQAEKMDHHPEWFNVYNKVQITLSTHDCGGLSQRDITLATFIDQA
SLM
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttttgggcagaaatgtccacgtctcctttctgtccctcatgtcctgccacg
ctgcaggccggtaagatccagactctgagcgacgaggagcgcgctcacctgctgccgctg
ctgcgaaacgcccagtgggtggaggcggtcggccgcgacgccatctacaaagaattcatt
ttcaaagacttcaatcaggctttcgggttcatgtccagagtggccttacaggcggagaag
atggaccatcatcccgagtggttcaacgtttacaacaaggtccagatcacgctcagcacc
cacgactgcggcggattgtctcagcgcgacatcactttggccaccttcatcgaccaggcc
tccctcatgtga

DBGET integrated database retrieval system