KEGG   Poecilia reticulata (guppy): 103479205Help
Entry
103479205         CDS       T05149                                 

Gene name
tyw3
Definition
(RefSeq) tRNA wybutosine-synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pret03016]
    103479205 (tyw3)
Enzymes [BR:pret01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     103479205 (tyw3)
Transfer RNA biogenesis [BR:pret03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    103479205 (tyw3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 DUF499
Motif
Other DBs
NCBI-GeneID: 103479205
NCBI-ProteinID: XP_008431728
UniProt: A0A3P9P923
Position
LG17
AA seq 266 aa AA seqDB search
MDRTFSRMKTQSLNRLDLSKKGSVDEDIEHVVSLLNSCDQFFTTSSCSGRIILIDGAAGS
SDAHKQNCVWLFVSHQKCTCDDLMSGLSRSCGDAVLKFEPFVLHVKCRRIEDAQLLHSVA
VNSGFRNSGLTVGKTGKIVSAVRSTHGLEVPLSRHGKLLVDEGYIQFLTQTANQKMEENL
RRVQRFFQNLQSAMSAERHQIPDSPGTHEHQDSQHTHKKGRRGGQGTNKQNQLNVYKLRH
QHETDGCLGYGDSSLPELDDCLDLFT
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggacagaacgttcagtcggatgaagacacagagtctgaatagactggacctgagtaag
aaaggcagcgtggatgaagacattgaacatgtggtgtctctgctcaacagctgtgatcag
ttcttcaccaccagctcatgttccggcaggatcatcctcatcgatggggcggcaggcagc
agtgatgcccacaaacagaactgtgtctggctgtttgtctcacaccagaagtgcacctgt
gatgacctgatgtcaggtctgagcagatcctgtggagatgccgtgttgaagtttgaaccc
tttgttctccacgttaagtgccgcaggatagaggatgcacagctgctgcattcagtggct
gtcaactcaggcttcaggaactctgggctcactgttggcaagacagggaagattgtatcg
gcggttcgcagcacgcacggcctggaggttcccctgagccgtcatggaaaacttttagtt
gatgaaggctacatccagttcctgacacaaacagccaatcagaagatggaagagaacctc
agacgggtacagaggttcttccagaacctccagtcagccatgtcagcagagagacatcaa
atcccagacagccctggcacacatgaacatcaagattcccaacacacacacaagaaagga
aggaggggaggacagggaacaaataaacagaaccaactaaatgtgtacaaactgagacat
cagcatgagactgatggttgtcttggttacggggacagcagcctgcctgagctggatgac
tgtctggacctgttcacatga

DBGET integrated database retrieval system