KEGG   Poecilia reticulata (guppy): 103479812
Entry
103479812         CDS       T05149                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pret03021]
    103479812 (aff3)
Transcription machinery [BR:pret03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103479812 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 103479812
NCBI-ProteinID: XP_008432696
Position
LG2
AA seq 1159 aa
MARPPYVAPHKSMLADDLKISSDEDDTQRAIHESASWDRHSLTDSLSAQRAHTHGXRVRH
SSSDSSDSDSSAESGSSLRSRSPSPELHPDPPSPASVQPLCNNKEIDHRSTTQWQLDKWL
KRSKKKSARTDQDLSQAIAEPEASPLSQRAPSPARSWDSNQEYSPSQTPIPSPQFSYSND
NSPVPSPGYSYCPSPSPFPSTCPSPTPSQQHSPPPSPVLSVCPSPCGTPRTSRSPSPIPK
HPPRSPSPTLPTPSRGFHYHGSQSQNQSHSILTSTPHRTKIRPWIAPLPGTSLKSKPTSN
IHLQPPYQLKPKNHHTQDQVQSQSKLKDFGGLNSQLNLNQKSTHKPTSYPRTKQLSNAPK
TKNPTHFDQIQGNQSKPKPLPPFQQPSQQSPKRTKHLVPTGCETNTAPSTHSTSASKATR
NSVTGSTSGPFSNLIHWTKLWEATNSNPTHPNHAKTSQRKPQSKEQEVVQRKPHPTQAER
RIHESKEDRHHHEKQLGKLERKEDRRLAEEQLLRRPWIQSSPEEEEEEEERITEQQGGRK
NTGRGENRRKGEQAKEEWKAVRQVPSNDKQHRLRESLDCQGRTKKGRRCEEKREVIRDQS
PLLSTHSPPPQRPSFNSSSSSSSSTTSSNSDSESEYLGTIPKVSAESTSHRRVTKTGNQA
PSRPETTRPKAVHPRRHSSDNPCERQKSEAKKRLYTLVPFGRGEKTPSTAQRGLRNLVVQ
IDLCLLKRVPDSPTDSTGKKLSPSKSSSLMKEKSKEAMKHVYDPETSITDGKRKRKLENG
VTQRETKRSLLYPSETPGQKEPSSLPAENIITETVHNGYLEEFLDNKRPVSPLSPLSPLP
QSPEPTRPVSKAKTTTEQQQSRAQKSKDKSRDADVKPKTEVECVKVSRQHQPLPESTWGP
AGHRGTVPSQEISHHAEYYLHEAKRMKHRADAMVDKLGKAVNYVDAALSFMECGKAMEEG
PLEAKSPFTMYSETVELIRYAMRLKGHSGPGARQEDKQLAVLCFRCLALLYWQMFRLKKD
HALKYSKVLLDFFKSSPKVPTTPPGWMDSGKPTAGLPSSLSPTAKHHRRGSNEGSSSASL
ISIPQRIHQMAANHLNITNSVLYSYEYWEVADNLAKENKEFFNYLNTLSGPLTLHSSIAH
AVQYTRQALQWIRISAKLN
NT seq 3480 nt   +upstreamnt  +downstreamnt
atggctcgtcctccctacgtggcacctcacaaatcaatgcttgctgatgacctgaagata
agtagtgatgaagatgacactcagagggccattcatgagtcagcttcctgggacagacac
agtttgactgacagcctgtcggcgcagcgagcgcacacgcatggcargagggtgagacat
tccagctcggactcctcggactctgactcctctgcagagtcgggcagcagccttcgttcc
cgcagcccgagtccagaacttcacccggatcctccgtcgcctgcgagcgtgcagccactg
tgcaacaacaaggagattgaccatcgttccactacccagtggcagttagacaaatggctg
aaaagatcaaagaaaaaatctgccaggactgatcaagatttgtctcaggctattgcagaa
cccgaggcctctcccctaagtcagagagccccgtcaccagccaggtcatgggacagcaat
caagagtatagcccgagccaaacccccattccaagtccacagttcagttacagtaatgat
aacagcccagttcctagccccggttacagctactgcccaagtcccagccctttccccagc
acctgtccaagtcctacccctagtcaacaacatagcccacctccaagtccagttctaagt
gtttgccccagtccttgtggaacaccgaggaccagtcgtagcccaagccctatacctaaa
catcccccaagaagtcctagtcccaccttacccactccatcacggggttttcactaccat
gggagtcagagtcagaaccagtcgcattctattctaacatctaccccccacaggactaaa
ataagaccatggattgcaccattgcctggcaccagtttaaagagtaagcccacgagtaac
attcatcttcaaccgccttatcagctcaagcctaagaatcatcacacacaagaccaagtc
caaagccaaagcaagttgaaagattttggaggcttaaattcccaattaaatctcaatcaa
aaatctacacacaagcctacttcatatccaagaactaaacagctttccaacgcccccaaa
actaaaaatccaacacattttgatcaaatccaaggcaaccaatccaaacccaagccactg
ccaccatttcaacaaccttcacagcaaagccccaaaagaacaaagcatttagtgcctact
ggctgtgaaaccaacacagctcccagtactcattccacatctgccagtaaagctactaga
aattctgttactgggtcaacctctggaccattctctaaccttatacactggacaaagctg
tgggaagctacaaactcaaaccccacgcatccaaaccatgccaaaacctcacaaaggaaa
cctcagtctaaggaacaggaagtagttcagagaaaacctcatccgacccaagcagagagg
agaatacatgaaagcaaggaggatagacatcatcatgaaaaacaactagggaaactagaa
cgaaaggaagacagaaggctggcggaggagcagctactaagacgcccctggatccaaagt
tcaccagaagaagaggaggaagaggaggaaagaataacagaacagcaaggtgggagaaag
aacacaggaagaggagaaaataggaggaagggggagcaggcaaaggaagaatggaaagcg
gtcagacaagtgccttctaacgacaaacaacaccgccttcgagagagtttagactgtcaa
ggcaggacaaaaaagggaagaagatgtgaggagaagagagaagtaatcagagaccaatca
cccttattatccacacactccccacctccccagaggccatccttcaactcctcctcctca
tcatcatcttccacaacctcctccaactcagactctgaatctgaatatcttggcactatc
cccaaggtttcagctgagtccacttctcacaggagagtcaccaagacagggaaccaagct
ccaagcagacctgagactaccaggcctaaggcagtacaccccagacgacacagctcagat
aatccatgtgagaggcagaaaagtgaggcaaagaaaaggctctatacactagtccctttt
ggacgaggggaaaaaactccttccaccgcccaacgggggctacgaaatctggtggtgcag
atagacctctgtcttctcaagagagtcccggacagtcccacagattccactggtaaaaaa
ctatccccttccaaatcatcttcattgatgaaggaaaaatctaaggaggctatgaaacac
gtttatgaccctgagacctccattacagatggcaaaaggaaacgcaagctagagaacggc
gtaacgcaaagagaaaccaagaggagtcttctttatccaagcgagacaccagggcagaaa
gaaccttcatcattaccagctgagaacatcattactgagactgtgcacaatggatacctg
gaggagttcttggacaacaagaggccagtgtctcccttgtctcccttgtctccactgccc
cagagccctgaacccaccaggcccgtctccaaagcaaagacaactaccgaacagcaacag
tcccgggcacagaagagcaaagacaagagcagagatgcagatgtaaagcccaagactgag
gtggagtgtgtaaaagtatcaaggcagcatcagccactacccgagtccacctggggacca
gctggtcacagagggaccgtaccaagccaagaaatttctcaccatgctgagtactactta
catgaagctaaacgaatgaagcaccgtgctgatgcaatggtggacaagctcggaaaagct
gttaactacgtcgatgcagctctgtccttcatggaatgtgggaaggcgatggaggagggg
ccactcgaggcaaagtctcctttcaccatgtattctgagacagtggagctgatccggtac
gcaatgaggctcaagggtcactctggccctggagcgagacaggaagacaaacagctggca
gtgctgtgtttcagatgccttgccctcctttactggcagatgtttcgcttaaaaaaagat
catgcattaaagtactccaaagtgctgctcgactttttcaagagttctcccaaagtgcct
acaacgccacccggctggatggactctgggaagcctacagcaggactcccgtcctcactg
tcacccactgcaaaacaccacagacggggttcaaatgagggcagcagctctgcgtcgctc
ataagcataccccagcgcatccaccagatggcagcaaaccacctgaacatcaccaacagt
gtcctgtacagctatgaatactgggaggtggcagacaacctcgcaaaggagaataaagaa
ttcttcaattacttgaatactttatctgggccattgactcttcacagtagcattgctcac
gctgttcagtacaccaggcaggctcttcagtggatacgcattagtgccaaattgaactga

DBGET integrated database retrieval system