KEGG   Poecilia reticulata (guppy): 103479957Help
Entry
103479957         CDS       T05149                                 

Gene name
nmnat2
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00760  Nicotinate and nicotinamide metabolism
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    103479957 (nmnat2)
Enzymes [BR:pret01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     103479957 (nmnat2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     103479957 (nmnat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 103479957
NCBI-ProteinID: XP_008432898
UniProt: A0A3P9Q3K4
Position
LG17
AA seq 307 aa AA seqDB search
MTETSKTHVILLSCGSFNPITKGHIHMFEKAREFLHKTGRFIVIGGIISPVHDSYGKPGL
VSSRHRLTMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
STTPVIGQPQNQTPPIYQDHNNMNHKPTAIKVWGKISESLGKICCVRPNMERFTFVDENA
NLGTAVRYEEIELRILLLCGSDLLESFCIPGLWKDSDMEVIVGDFGIVVVPRDGVDTERI
MNHSSVLRKYKDNIVVVKDATHHPMSIVSSTKSRLALQHGDGHVVDYLSQPVIDYILQSQ
LYINASG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaccagcaagacgcacgtgatcctgctgtcctgcggcagcttcaacccgatc
accaagggacacatccacatgttcgaaaaagccagagagtttctgcacaaaacgggacga
ttcatcgtgatcggaggaatcatctcaccggttcacgactcctacggaaaacctggtttg
gtgtcgagccgccatcgcctcaccatgtgccagctggccgtccagaactcggactggatc
agggtggacccctgggagtgttaccaggacacctggcagaccacctgcagcgtgttggag
caccaccgcgacctcatgaagagagtcaccggctgcatcctgtccaacgtcaacacgccc
tccaccacccctgtgattggtcagccacagaaccagactccgcccatctaccaggaccac
aacaacatgaaccacaaacccacagccatcaaagtttgggggaagatcagtgagagtctg
ggtaaaatctgctgcgtccgacccaacatggagcgcttcacgtttgttgatgaaaacgcc
aacctggggacggcggtgaggtacgaggagatcgagttgcgcatcttgctcctgtgtggc
agtgatctcctggagtccttctgcatccctggcctctggaaggacagtgatatggaggtg
attgttggtgattttggcatcgtggtcgttcctcgtgacggcgtcgacacagagaggatc
atgaaccactcctccgtcctccgcaagtacaaggacaacatcgtcgtggtgaaggacgcg
acccaccaccccatgtccatcgtcagctccaccaagagcagactggccctgcagcacgga
gacggacacgtcgtcgactacctgagtcagcctgtcatcgactacatcctgcagagccag
ctgtacataaacgcctcgggatag

DBGET integrated database retrieval system