KEGG   Poecilia reticulata (guppy): 103481404Help
Entry
103481404         CDS       T05149                                 

Definition
(RefSeq) fructose-bisphosphate aldolase A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00030  Pentose phosphate pathway
pret00051  Fructose and mannose metabolism
pret01100  Metabolic pathways
pret01200  Carbon metabolism
pret01230  Biosynthesis of amino acids
Module
pret_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pret_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103481404
   00030 Pentose phosphate pathway
    103481404
   00051 Fructose and mannose metabolism
    103481404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pret04131]
    103481404
   03036 Chromosome and associated proteins [BR:pret03036]
    103481404
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pret04147]
    103481404
Enzymes [BR:pret01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     103481404
Membrane trafficking [BR:pret04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103481404
Chromosome and associated proteins [BR:pret03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103481404
Exosome [BR:pret04147]
 Exosomal proteins
  Proteins found in most exosomes
   103481404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic DUF2680
Motif
Other DBs
NCBI-GeneID: 103481404
NCBI-ProteinID: XP_008435032
UniProt: A0A3P9QJ49
Position
LG19
AA seq 363 aa AA seqDB search
MPHAYPFLTPEQKKELSDIAQKIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYR
QLLFTADDRIVPCIGGVILFHETMYQKTDDGKTFPQYLKERGMVVGIKVDKGVVPLAGTN
GETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSKLAILENANVLARYASICQM
HGIVPIVEPEILPDGDHDLKRCQYITEKVLAAVYKALSDHHVYLEGTLLKPNMVTSGHSC
SHKYSNQEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASVNLNAMNQCPLHRPWALTF
SYGRALQASALKAWGGKKENGKACQDEFIKRALANSLACQGKYVSSGTSAAGGDSLFVAN
HAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgcttatcctttcctcactcctgagcagaagaaggagctcagcgacattgct
cagaagattgtcgctccaggcaagggaatccttgctgcggatgagtccacagggagtgtg
gctaagcgcttccagagcatcaatgctgagaacactgaggagaacaggaggctgtaccgc
cagctcctcttcactgctgacgaccgcatcgtcccttgcattggtggcgtcatcttgttc
cacgagaccatgtaccagaagaccgacgatggaaagaccttccctcagtacctgaaggaa
agaggcatggtggtcggcatcaaggtagacaagggcgttgtccctctggccgggaccaac
ggcgagacgaccacccagggtcttgatggactgtatgagcgctgcgcacagtacaagaag
gacggtgctgacttcgccaagtggcgctgtgttctgaagatcacgcccaccaccccctca
aagctggccatcttggagaacgccaatgtcctggctcgctacgccagcatctgccagatg
cacggcatcgtccccatcgttgagccggagatcctccctgatggcgaccacgacctgaag
cgctgccagtacatcaccgagaaggtcctggccgccgtctacaaagccctctccgaccac
cacgtctacctggagggcaccctgctcaagcccaacatggtcacctccggacactcctgt
tcacacaagtacagcaaccaggagatcgccatggcaacggtcactgccctgcgtcgcact
gtgccccctgcagtcccaggaatcaccttcctctctggcggccagagcgaggaggaggcc
tctgttaacctgaatgccatgaaccagtgccctctgcaccgaccttgggctctgaccttc
tcatacggccgcgccctgcaggcctccgccctgaaagcctgggggggcaagaaggagaac
ggaaaggcatgccaagatgagttcatcaagagagctctggccaacagcctggcctgccag
ggcaaatacgtttcctctggaaccagcgctgctggtggagactcactgtttgtggctaat
catgcttattaa

DBGET integrated database retrieval system