KEGG   Poecilia reticulata (guppy): 103482126Help
Entry
103482126         CDS       T05149                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret00010  Glycolysis / Gluconeogenesis
pret00562  Inositol phosphate metabolism
pret01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pret00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103482126 (minpp1)
   00562 Inositol phosphate metabolism
    103482126 (minpp1)
Enzymes [BR:pret01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103482126 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103482126 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103482126
NCBI-ProteinID: XP_008436301
UniProt: A0A3P9MYK7
Position
LG19
AA seq 467 aa AA seqDB search
MFDLGTHGFLWLAALSLIPTRVFCSSAEIPDVPSIATYFGTKTRYEEVKPNLLRDPLTVN
TSVLRPPPGEFCTPFHVTAVIRHGSRFPTIKNIRRIHRLSELLQNEGSRTSESSAGWLDE
LRNHWEPWYTEDMDGRLVRKGREDLQFLAQRLATLLPSLLSEENVRKRRIHFVTSSKHRC
VSSVEAFQEGLQQHWSCHDSAQGYNHEVDDELMRFFERCRGYVESVENNHTALLEVEKFK
HGKEMQAVRKRLAEKLGLSLHLLTPDLVEAAFFICSYELSIKSIHSPWCFLFDESDAKVL
EYSFDLKQFWKRSHGHLISSLSSCPLFHHIFRTLDKAGRPRRSTETGPEPASVLVGHAET
LIPLISLLGLYKDQTLPTASNYHSQHGRRFRIIPYAANLLFILYDCQRGPRLQLLINETP
LRFPNFQTEDAPLYRDVRAAYRYLLDGCDFKTECERKPEGRGPNTEL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatctcggaacacacggattcctgtggctggcggctctcagcctaattccgacc
cgtgtattctgctcttccgcggaaataccggatgtccctagtattgccacttacttcgga
actaagactcgctatgaggaggtgaaaccgaacctactccgagaccctttaaccgtgaac
acctcggtcctcagacccccgccaggtgagttttgcaccccattccacgtgaccgccgtc
attagacacggcagccggtttcctaccatcaagaacatccgcagaatacacagactaagc
gagctactccagaacgaaggttccagaacctcagagagctccgctggctggctggatgag
ctccggaaccactgggaaccctggtacaccgaggacatggacggtcggctggtgaggaag
ggtagggaggacctccagttcctggcccagcggctggccactttgttaccatctctgctg
tcggaagaaaacgtgaggaagaggagaatccactttgtgaccagctctaagcatcgctgt
gtgagcagcgtggaggcattccaggagggtctgcagcagcactggagttgccatgacagt
gctcaaggatacaaccatgaggtggatgatgaactaatgcgcttctttgagcgttgccgt
ggttatgtggaatccgtggagaacaaccacactgcgctgctggaagttgagaagttcaaa
catggcaaggaaatgcaggcagtgaggaagaggttggctgagaaactcggcctttctctt
cacctactcaccccagacttggtggaagcagcgttcttcatctgttcctacgaactgtcc
atcaaatccatccactcaccatggtgcttcctgtttgatgaaagtgatgcaaaggtgttg
gagtacagttttgatctgaagcaattctggaagcgctctcatggtcacttaatcagcagt
ctgtccagctgtccgctcttccatcacattttcaggactctagataaagctggtcgtcct
cgcagatccaccgagacaggcccagaaccagcctctgtcttggtgggacatgctgagacg
ctgatccccctcatctccctacttggactgtacaaagaccagactttgcccactgctagc
aactaccattcacagcatggaagacgtttccgcatcattccatacgctgccaacctgctc
ttcattctctatgactgtcagcgtggcccccgactacagctgctcatcaatgagacacca
ctacgctttccaaactttcagactgaggatgcaccactctacagggatgttcgtgcagca
taccgctacctgctagatggctgtgacttcaaaacagagtgtgagaggaaaccggaaggc
cggggacccaacactgagctttga

DBGET integrated database retrieval system