KEGG   Poecilia reticulata (guppy): 103482270
Entry
103482270         CDS       T05149                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
pret  Poecilia reticulata (guppy)
Brite
KEGG Orthology (KO) [BR:pret00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103482270 (ahrr)
Transcription factors [BR:pret03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    103482270 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 103482270
NCBI-ProteinID: XP_008436543
UniProt: A0A3P9NUM8
Position
LG20
AA seq 682 aa
MIPPGDCMYAGRKRRKPVQKQKPSSVNEKSNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKPSRKHVTTPASSNPEPRKDSLPLGTTINESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQAMSGQSDGQLAAGTSEDFVVSSMFNSPEAGEIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSPSGTQVPAQLGLFCIAVPLLLPSITEMKVKNILMRGKN
KGGGITSPMEHGERGEHLRRHSIGGGMGDMTDPLLFTCPHPGATQRSHHTLWSPLCKDNL
KCSSDGFYGQEEPLNFCKSSVADHKDAAVGLGGGWPMRQRVGPVRAAQGVGYVPSNRLNR
TGQYGKPYRLSPSCHGGRGADVYVSKLYGSSDADAYCVDLVKSENDFGECYEGHMMSEMP
PIKIEHDSDSENGCETYGQTWACRNQAIIDRHYGNGVFDPSTGLQLKSETDYYDPQFSPC
QRGKAGISPTYNNGAYPGYAVNSAARLLKCDKDLVSNGDSNQFSPQRLSHSDSLCSNQPV
NLMEPNVYPQKAYMHLDYSKHSAYEFKGHGLIHSIKREPMDSPPWSENGHDMNQSMMGGS
RNVMPCVMSTGHHKSSPYIYMQ
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgatcccacctggagactgcatgtacgcgggcagaaagaggaggaagcccgtccagaaa
cagaaaccatcctctgtcaatgagaaaagcaacccgtccaagaggcaccgggacaggctc
aacgccgagctggaccgcctggccagcctgttgccattccctccggacgtcatctccaaa
ctggacaagttgtccgtgctgcgcctcgccgtctcctacctgcgcgtcaaaagcttcttc
caagcgagtcaagacaaaccctccaggaagcacgtcaccaccccagcatcctctaaccct
gaacccaggaaagatagccttcctctgggcaccaccatcaatgaaagcagcctcctcctg
gaatctctaacaggctttgccttggtggtgagcagtgatggcatggttttttatgcttcc
tcaaccattgtggactacttgggtttccatcagaccgacgtgatgcaccaaaacgtcttc
gactacatccacatagacgaccgccaggagttcagacgccagctccactgggccatgtgt
cccccacaacatcaggcgatgtctgggcagtcagatggccagttagcggcgggaacaagt
gaagactttgtcgtgagcagcatgttcaactctccggaagcaggggaaattcccccagag
ctctcctgctttctcaacagatgtttcatagccagagtccgctgtctcctggacagcacg
tctgggtttttgacgatgcagttccagggtcggttaaagttcctccacgggcagaaaaag
aagtcgccctctgggacgcaggttcccgcccagctgggtctgttctgcatcgccgtgccc
ctcttactgccctccatcaccgagatgaaagtgaaaaatattttaatgcggggaaagaac
aaaggtggggggattacctctccgatggagcatggtgagcgtggggagcacctacggagg
cattccatcggtggaggaatgggtgacatgacagaccctcttctcttcacttgtccccat
ccgggcgctacacagcgaagccaccacacgctctggtcccctctttgcaaagacaacctc
aagtgcagctccgacggcttctacggccaggaggaacccctcaacttctgcaagtcctcc
gtggcggaccacaaagacgcagccgtgggcctgggcggagggtggcccatgcggcagcgg
gtggggcccgtcagagccgcccagggagtcggctacgtcccatccaaccgtctgaacagg
actggccagtacgggaagccctaccgcctctcgccgagctgccacggcggccggggcgca
gacgtgtacgtgtcaaagctgtacgggtcttcggatgcggatgcctactgcgtagacctg
gtgaagagcgaaaacgacttcggggagtgctacgaaggccacatgatgtctgagatgccg
cccattaaaatagagcacgactccgactcggaaaacggatgcgagacgtacggtcaaacc
tgggcctgccgcaaccaggccatcatcgaccgtcactacgggaacggggtgttcgacccc
agcactggcctgcagcttaaatcggaaacggactactatgacccgcagttctccccgtgc
caacgagggaaagcaggaatcagccccacgtacaacaacggcgcctaccccggctacgcg
gtcaacagcgccgctcgtctgctgaagtgcgacaaagacttggtcagtaacggcgactcc
aaccagttcagtcctcagagactctctcactcagactctctatgcagcaaccagccggtg
aacctcatggagccaaacgtctaccctcaaaaggcgtacatgcacctggactacagcaag
cacagcgcctacgagttcaaaggtcacggcttgatccactcgatcaaacgggagccgatg
gactccccgccctggtctgagaacggccatgacatgaaccagtccatgatgggcggttca
aggaacgttatgccatgtgtgatgagcacaggccaccacaagtccagtccctacatttac
atgcagtga

DBGET integrated database retrieval system