KEGG   Poecilia reticulata (guppy): 108166175Help
Entry
108166175         CDS       T05149                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108166175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pret04030]
    108166175
G protein-coupled receptors [BR:pret04030]
 Rhodopsin family
  Lipid
   Leukotriene
    108166175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx TraL
Motif
Other DBs
NCBI-GeneID: 108166175
NCBI-ProteinID: XP_017159394
UniProt: A0A3P9N4C8
Position
LG3
AA seq 352 aa AA seqDB search
MNISHSRSPLEEMALEEFDSGTVVACVILGLSFLVGAPGNLLVIWTILKHVKKRSHTVVL
ILHLAAADLMVLITLPLWIYSLAQSWVFGEACCKVMVFLINACMYSSVFLITLMSVERFV
AVRYPFVSVVWKKKQALNKVLLALWSAGFLFSIPIILTQTAEGDYGKTDCVYRVYTSDTQ
ELVCLLLETMVGYMLPFSILVVCYGCLCSRITQMNFRSKRKSTVLIASIVVAFAICWTPH
HIGNIISIVILAIGDSKSDIANKLETARQTMMFVAGAMVFISSSINPVLYMFAARSFRES
LRDTGIQKLFRHISSTSPGEGNREISFVSKRQSNQTNCSQLMTESKDDINMY
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacatctcacattcacggtctccgttggaggaaatggccctcgaggaatttgacagt
ggaacagtggtggcgtgtgtgatcytgggtctgtccttcttggttggtgctcctggcaac
ctgcttgtgatctggaccatcctgaagcatgtgaagaagcgctcacacacagtggttctc
atcctgcacctggcggcggcagatctgatggtcctcattacactccctctctggatctac
tccctcgcccagtcctgggtcttcggcgaggcatgctgcaaagtcatggtgttcttgatc
aacgcctgtatgtacagcagygttttcctcatcacgctcatgagtgtggagcgtttcgtc
gccgtgcgttatcccttcgtctctgtagtttggaagaagaaacaagccttgaataaagtc
ctgcttgccctgtggtcagctgggttcctgttcagcatacctattattctgactcaaact
gccgagggggactatggtaagacggactgcgtgtatcgcgtgtatacttctgacactcag
gagctggtatgtttgttgctagagacgatggtgggatacatgctrcccttctccattctt
gtggtctgttatgggtgcttgtgcagtcgtataactcagatgaactttaggtccaaacgc
aagtccactgtcttgattgcaagcatagtggttgcatttgccatttgctggacaccccat
catataggaaacatcatctccattgttattctggccattggagactcaaagagtgacata
gccaataaactggaaactgctagacaaaccatgatgttcgtagcgggagccatggtcttc
atcagcagcagcattaatcctgtcctctacatgtttgcggcccgctccttcagggagtcg
ctacgtgacaccggcatccagaaactcttccgccacatctccagcacatcgccgggtgag
ggaaacagggagatatcctttgtgtcgaagagacaaagcaatcagacgaactgttctcag
ctcatgacagagtcaaaagacgatattaatatgtattga

DBGET integrated database retrieval system