KEGG   Poecilia reticulata (guppy): 108166658
Entry
108166658         CDS       T05149                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04080  Neuroactive ligand-receptor interaction
pret04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pret00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108166658 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108166658 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 108166658
NCBI-ProteinID: XP_017162700
Position
LG10
AA seq 75 aa
MNVKILTLVIVLLVSLLCPAGAGPMASTEHGRGLEEAATVRKMAQQNPVRGGQTHRPAKR
RRPRPRLSHKGPMPF
NT seq 228 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgtcctgcc
ggtgctggtcccatggcctccacggagcatggcagagggctggaagaggcagctacagtg
agaaaaatggcccagcagaacccagtgagaggcggtcagacccacagaccagccaagaga
agacgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system