KEGG   Providencia rettgeri: RB151_015880Help
Entry
RB151_015880      CDS       T04571                                 

Gene name
recD2_2
Definition
(GenBank) ATP-dependent RecD-like DNA helicase
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
prg  Providencia rettgeri
Pathway
prg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:prg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    RB151_015880 (recD2_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prg03400]
    RB151_015880 (recD2_2)
Enzymes [BR:prg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     RB151_015880 (recD2_2)
DNA repair and recombination proteins [BR:prg03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RB151_015880 (recD2_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 Viral_helicase1 UvrD_C_2 SH3_13 PhoH AAA_11 PIF1 UvrD-helicase AAA_22 Helicase_RecD AAA_16 AAA_28 AAA DUF853 T2SSE AAA_14 ATP_bind_1 AAA_23 DUF2075 RsgA_GTPase NTPase_1 AAA_29 NACHT Herpes_Helicase AAA_7
Motif
Other DBs
NCBI-ProteinID: APC11268
Position
complement(1781260..1783434)
Genome map
AA seq 724 aa AA seqDB search
MHEEYFRVTSCQHNGYKYTIFTGVPLKTDSYKINSGKYIVSIRCENQSLPIKPSVGQQWR
VRGVRTLETVQAGDYKLQQHLYDAPAEMECTLPETGEALIRFIANEKEFTGIGEAKARAL
WNVFGSDLHPMLQSNTSEHRGRLREVLSEVSVTALYNGYAKYKNLAHANWLASLGVPLSI
QQRILKYHDNRTVEVLKTNPYALLGFGMPFPDIDAIAEKMGMDKSAPVRLAAALESAIRK
EVEKGHTYASHPALRPEVTKLLGDKALVAEAFASGYRNGQFILRPETGTYHPTAQIMMES
VVAKRLKALAAIKNEDESVFKALTEAVQELPYDLTEQQVQAVELSLTNAVSCITGGAGTG
KTTVLRAVLKAYAALGYQVHAVALSGRAAMRLHESIGFFTMTIARLLREEPISPSLDQAQ
HLLVIDEASMTDLPTMYRIVTHLDPSVRIILTGDPNQLPAIGCGKVLSDIVESGAIATVE
LNIVKRQEDSTGIPEYSATINRGEVPPALSVGAITFHETPPQKMVDKCKSLYAESPYNTQ
IIGATKALVGEVNRECQKLINPDGECLQFRLHGDEFFLDIRVGDPILFTRNKYNIGIQNG
SLGVLSSTERDTKDGQETFGVVTLDTGEAISITDEVFDCMELGYGITLHKAQGSQFPRII
VAVQTGRISDRAWLYTAITRAEAEIHIVGQASDFASIVKSVSNATRRASFLRELLQERDS
GVSH
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagagtatttccgtgtcaccagctgccagcataacggctataaatacacgatc
ttcacgggcgttcccctcaagactgacagttacaagatcaactcgggcaaatacatcgtc
agcatccgatgcgaaaaccagtccctgcctatcaagccgtccgttggtcagcaatggcga
gtgcgtggcgtaaggacgctggagaccgttcaggcaggcgattataagcttcagcaacat
ttgtatgacgccccagctgagatggagtgcacgctgccggaaacgggcgaggcgctgatc
cgtttcattgccaatgaaaaggagttcaccggtatcggtgaggccaaagcacgcgccctc
tggaacgtttttggcagtgacctgcaccccatgctccaatccaatacctccgagcacaga
ggccgtctcagggaggttcttagcgaggtttcagtaaccgcgctatacaacggctacgcc
aagtacaaaaaccttgcgcatgcgaattggctggcttctctgggagtgccgctgagcatc
cagcaacgcattctaaagtaccacgataatcgaaccgttgaggtactcaagaccaatccc
tacgcattgctcggattcggaatgccttttcccgatatcgatgcgattgctgaaaaaatg
ggcatggataaatcggcaccggtgcggctcgcagctgcgttagaaagcgcgatacgaaaa
gaggtagaaaaggggcacacctacgcctcccatccggcgctcaggcccgaggtgaccaag
cttctgggcgataaagctctggtcgcagaggcgttcgccagcggttatcgcaacggccag
ttcattctcaggccagagaccggcacctaccaccctaccgcccaaatcatgatggagtcg
gtcgttgcgaagcggctcaaggccctggccgccatcaagaatgaagatgaatccgtcttc
aaggcgctcaccgaggccgttcaggagttgccctacgacctgaccgagcagcaggtccaa
gcggtcgagttgagccttaccaatgcggtgtcctgcattacgggtggtgccggtacgggt
aaaaccacggtccttcgtgccgtgctcaaagcctatgccgcactaggctatcaggttcat
gccgtcgctctgtcggggcgagctgctatgcgactgcacgagagcatcggattcttcacc
atgacaattgctcgcctgttgcgggaagagccgatctcgccgtcactggatcaggcgcag
catctcctggtcatcgacgaagccagtatgaccgacctgccgaccatgtatcggattgtt
acgcacctcgatccttcggtacgcatcatcctgaccggcgatccgaaccagctaccagcc
atcggctgcggcaaagtcctctcagacatcgttgagtccggtgcaatcgctacggttgag
ttgaacatcgtcaaacgccaggaagactcaacgggcatcccggaatactcggccaccatc
aatcggggtgaggtgcctcctgcgttatcggttggcgcaatcacgttccacgagacgcct
ccgcagaagatggtcgataagtgcaaatccttgtatgcggagtcaccctataacactcag
atcatcggagccaccaaggctctagttggcgaggtgaaccgtgagtgccaaaagctgatc
aatcccgatggggagtgcttgcagtttagactgcatggcgatgaattcttcctcgatatc
agagtgggcgacccgatcctcttcaccaggaacaagtacaacatcggcattcagaatggg
tctcttggcgtattatcctcaacagagcgcgacaccaaggacggccaggaaacatttggt
gtcgtgacgctggataccggcgaagccatttcaattacggatgaagtcttcgattgcatg
gagcttggctacggaatcacgctccacaaggctcaagggagccagttcccgagaatcatc
gtggcagtccagacggggcgtatctcagaccgtgcgtggctttacacggcgattacccgt
gccgaggcagagatacatattgtcgggcaggctagtgattttgcgtccatcgtaaaatcg
gtaagcaatgccaccaggcgggcgagtttcttgagggagctgctgcaagagagggattcg
ggggtaagccattaa

DBGET integrated database retrieval system