KEGG   Providencia rettgeri: RB151_027360Help
Entry
RB151_027360      CDS       T04571                                 

Gene name
mtlD
Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
prg  Providencia rettgeri
Pathway
prg00051  Fructose and mannose metabolism
prg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RB151_027360 (mtlD)
Enzymes [BR:prg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     RB151_027360 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA UDPG_MGDP_dh_N F420_oxidored Sacchrp_dh_NADP DIM1
Motif
Other DBs
NCBI-ProteinID: APC12403
Position
complement(2967020..2968180)
Genome map
AA seq 386 aa AA seqDB search
MKVIHFGAGNIGRGFIGKLLADANSQVTFTDVNQPLIDQLAHRQSYQVHIVGQENRIEKV
QHVHAVNSNDPKTIEFIAMADMVTTAVGPQVLEKIASTLAKGIIYREELGNTQPLNIIAC
ENMVRGSSQLKQHVLAQLPEKLHQWVERHIGFVDSAVDRIVPPMEAANDDPLDVTVESFS
EWIVDQTQFIGEIPTINGMELTDNLMAFIERKLFTLNTGHAITAYLGQLYGCQTISDAIA
EPKIYTVVKSAMEESGQVLIQRYGFNEETHCQYIDKILTRFANPYLKDDVNRVGRQPIRK
LSPNDRLVKPLLGTLEYQLPNKNLIIGIAAALHFRCDSDPQANEMAKRINENGVYQAVIE
FCALAQYPQVVEKICSQYQLMMLSNQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcattcattttggagcaggaaatataggtcgtggctttataggcaaactacta
gcggatgcgaattcacaagtgacttttaccgatgttaaccagccgctaattgaccaattg
gcccacagacaatcttatcaagttcatattgttgggcaagaaaatcgtattgaaaaagtt
caacatgtccatgctgttaatagtaatgatccaaaaaccattgaatttattgctatggct
gacatggtgacaacggcagtaggcccccaagttcttgaaaaaatagcctcgacattagcg
aaaggtattatttatcgtgaagaattagggaacacccaaccactcaacattattgcttgt
gaaaatatggttaggggaagtagtcaattaaaacagcatgtgttggcacaattaccagag
aaactacaccaatgggttgaacgacatattggttttgtggattcagctgttgaccgtatt
gtgccacccatggaggcggctaatgatgacccccttgatgttactgttgagtcttttagt
gagtggattgtcgatcaaactcagtttattggcgagatccctaccattaatggaatggag
ctaactgataatttgatggcgtttatcgaacgtaagttatttacattaaatacagggcac
gccattaccgcatatttggggcagttatatggttgtcaaacaattagcgatgcgattgct
gaaccaaagatttatactgtggttaaatctgcgatggaagaaagtgggcaagtattaatt
caacgttatggctttaatgaagaaacccattgccaatatattgataaaatattaactcgt
ttcgcaaacccttatttaaaagatgatgttaaccgtgtggggcgtcaaccaatacgtaag
ctgagtccaaatgataggctagttaagccactattaggtacacttgagtaccaattacct
aataaaaatctgattataggtattgctgctgcattacattttaggtgtgatagtgacccg
caagcgaatgagatggcaaaacgtatcaatgaaaacggggtttaccaagcagttattgaa
ttttgtgcattagcgcaatatccacaggttgttgaaaaaatttgttctcaataccaatta
atgatgttgagtaaccagtaa

DBGET integrated database retrieval system