KEGG   Providencia rettgeri: RB151_039740Help
Entry
RB151_039740      CDS       T04571                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
prg  Providencia rettgeri
Pathway
prg00071  Fatty acid degradation
prg00280  Valine, leucine and isoleucine degradation
prg00310  Lysine degradation
prg00362  Benzoate degradation
prg00380  Tryptophan metabolism
prg00620  Pyruvate metabolism
prg00630  Glyoxylate and dicarboxylate metabolism
prg00640  Propanoate metabolism
prg00650  Butanoate metabolism
prg00900  Terpenoid backbone biosynthesis
prg01100  Metabolic pathways
prg01110  Biosynthesis of secondary metabolites
prg01120  Microbial metabolism in diverse environments
prg01130  Biosynthesis of antibiotics
prg01200  Carbon metabolism
prg01212  Fatty acid metabolism
prg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RB151_039740 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    RB151_039740 (thlA)
   00640 Propanoate metabolism
    RB151_039740 (thlA)
   00650 Butanoate metabolism
    RB151_039740 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RB151_039740 (thlA)
   00072 Synthesis and degradation of ketone bodies
    RB151_039740 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RB151_039740 (thlA)
   00310 Lysine degradation
    RB151_039740 (thlA)
   00380 Tryptophan metabolism
    RB151_039740 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RB151_039740 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RB151_039740 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RB151_039740 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prg04147]
    RB151_039740 (thlA)
Enzymes [BR:prg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RB151_039740 (thlA)
Exosome [BR:prg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RB151_039740 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: APC13621
UniProt: A0A1J0ED34
Position
complement(4263035..4264219)
Genome map
AA seq 394 aa AA seqDB search
MKQANDIVIVSGVRTAIGTMGGSFANTHQHDLGALVIREAVKRAGIAPEDVNEVIVGNVG
QIAESGFIARICQLRAGLPKETTAYSVNRQCGSGLQALADGMMLLQTGQSDVVVACGTEN
MTMLPYYLRKARYGYRMGNDVLEDGLTSILTWPEGPYHNGMTAENVAEQFHISREEMDDF
AWNSQQKALKAIEEGYFQTQILPVEIAEGRKGTRIFDTDEHPRDTPREKLAKLRPAFKAD
GVITAANSSGINDGAAALVMMRREEAEKRGLKPRMKVVDWAVAGCEAAIMGFGPAPATRR
LMDKLKMDVKDIDLIELNEAFAAQAIAVMNDLSLDSSRVNVNGGAIALGHPVGASGAILP
VKLMYEMERRQVSTGLVTMCIGGGQGISMLFEKE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcaaatgacattgtgattgtaagtggtgtgagaacggcaattgggacgatg
ggtggtagctttgcgaacactcaccaacatgatttaggtgcgttagttattcgtgaagcg
gtaaagcgtgcagggatcgcccctgaagatgttaatgaagtgattgtggggaatgtgggg
caaatcgcagaaagtgggtttattgctcgtatttgccaattgcgagcaggcttaccaaaa
gaaacgaccgcgtattctgttaatcgccaatgtggttcagggttacaagcgttagctgat
ggcatgatgttgttacaaactggtcaatcagatgtggttgtggcttgtggtacagaaaat
atgaccatgctgccttattacctgcgcaaagcgcgttacggttatcgcatggggaatgat
gttttagaagatggcttaacgtcaattcttacttggcctgaaggcccatatcataatggt
atgaccgcagaaaatgtggccgaacaatttcatatttcccgtgaagaaatggatgatttc
gcatggaacagtcagcaaaaagcattgaaagccattgaagaaggctattttcaaacgcaa
attttgccagttgaaatcgcagaagggcgtaagggaacgcgtatttttgatacggatgaa
cacccgcgcgatacaccacgtgagaagcttgccaaattacgtcccgcatttaaggcagat
ggcgtgattacagcggctaattcatcagggattaatgatggagccgctgcgttagtcatg
atgcgacgcgaagaagctgaaaaacgggggttgaaacctagaatgaaagtggttgattgg
gccgttgcgggctgtgaggctgccattatggggtttggcccagcacctgcaacacgccgc
ttgatggataaactcaagatggacgtcaaagatattgaccttattgagttaaatgaagct
tttgccgcacaagcaatcgcagtgatgaatgatttgtcgttagacagttctcgagtcaat
gtgaatggcggcgcaattgcccttggtcaccctgttggcgctagtggagcaatcctacct
gtaaaattaatgtacgaaatggagcgtcgtcaggtttctactgggctagtgaccatgtgt
atcggtggtggtcaagggatatcaatgttgtttgaaaaagaataa

DBGET integrated database retrieval system