KEGG   Providencia rettgeri: RB151_039910Help
Entry
RB151_039910      CDS       T04571                                 

Definition
(GenBank) SMP-30/Gluconolaconase/LRE-like region
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
prg  Providencia rettgeri
Pathway
prg00053  Ascorbate and aldarate metabolism
prg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    RB151_039910
Enzymes [BR:prg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     RB151_039910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: APC13638
Position
4284593..4284817
Genome map
AA seq 74 aa AA seqDB search
MRYNPDGDIDRIIEMPVKKVTSVAFGGENLDILYVTSMARPPLPRFPEDGQLRGSVFSIH
NLGVKGIAEKRFGG
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
gtgagatataaccccgacggcgatattgacagaattatcgaaatgccagttaaaaaggtc
accagcgtcgcttttggcggcgaaaatttagatattttatatgttacttcaatggcaagg
ccaccattacctcgcttccctgaagatggtcaattaagaggaagcgtattctcaatacat
aatcttggtgtaaagggcatagctgaaaaaagatttggtgggtag

DBGET integrated database retrieval system