KEGG   Pseudomonas rhizosphaerae: LT40_10600Help
Entry
LT40_10600        CDS       T03339                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh00071  Fatty acid degradation
prh00072  Synthesis and degradation of ketone bodies
prh00280  Valine, leucine and isoleucine degradation
prh00310  Lysine degradation
prh00362  Benzoate degradation
prh00380  Tryptophan metabolism
prh00620  Pyruvate metabolism
prh00630  Glyoxylate and dicarboxylate metabolism
prh00640  Propanoate metabolism
prh00650  Butanoate metabolism
prh00900  Terpenoid backbone biosynthesis
prh01100  Metabolic pathways
prh01110  Biosynthesis of secondary metabolites
prh01120  Microbial metabolism in diverse environments
prh01130  Biosynthesis of antibiotics
prh01200  Carbon metabolism
prh01212  Fatty acid metabolism
prh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LT40_10600
   00630 Glyoxylate and dicarboxylate metabolism
    LT40_10600
   00640 Propanoate metabolism
    LT40_10600
   00650 Butanoate metabolism
    LT40_10600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LT40_10600
   00072 Synthesis and degradation of ketone bodies
    LT40_10600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LT40_10600
   00310 Lysine degradation
    LT40_10600
   00380 Tryptophan metabolism
    LT40_10600
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LT40_10600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LT40_10600
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LT40_10600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prh04147]
    LT40_10600
Enzymes [BR:prh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LT40_10600
Exosome [BR:prh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LT40_10600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIS17813
UniProt: A0A089YN19
Position
2323287..2324474
Genome map
AA seq 395 aa AA seqDB search
MNEDPIVIVSAVRTPMGGFQGDLRSLTAPQLGAAAIAAAVERAGVEAGSVDQVLFGCVLP
AGLGQAPARQAALGAGLPYATTCTTLNKMCGSGMQAMLMGHDALLAGSARVVVAGGMESM
SNAPYLLDRARDGYRMGHGRVLDHMFLDGLEDAYEPGRLMGTFAEDCAQGHGFSRQTQDE
FALASLSRARQAISDGSFTSQIVPVQVTRNKQTLTISDDEQPPKANPDKIPTLKPAFREG
GTVTAANSSSISDGAAALLLMRRSEAQARGLAPLAVIHGHTAFADAPHLFPVAPIGAIRK
LVETTGWALPDVDLFEINEAFAVVTLAAMQALDLPADKVNVNGGACALGHPIGASGARIV
VTLLAALRQRNLRRGIAAICIGGGEATAIAVECLY
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagatccgatcgttatcgtcagtgccgtgcgcacacccatgggtggctttcag
ggcgacctgcgcagcctgacggcgccgcagctgggcgcagccgccatcgccgcagccgtc
gagcgtgccggtgtcgaggctggcagcgtcgaccaggtgctgttcggctgcgtgctgcca
gccgggctgggccaagccccggcgcggcaggcggcactgggtgccgggctgccctatgca
accacctgcaccaccctgaacaagatgtgcggctcgggcatgcaagccatgctcatgggc
catgatgcgctgctggcgggcagtgcccgtgtggtggttgccggcggtatggaaagcatg
tccaacgcgccgtacctgctggaccgcgcccgcgacggttatcgcatgggccacggtcgg
gtactcgaccacatgttcctcgatggtctggaagacgcttacgaacccggccggttgatg
ggcacctttgccgaggactgcgcccaggggcacggtttcagccgtcagacgcaggacgaa
ttcgccctggcctcgctgagccgcgcacgccaggccatcagcgacggcagtttcacctcg
cagatcgtgccggtgcaggtcacgcgcaacaagcaaacgctaaccatcagtgacgacgag
cagccacccaaggccaatccggacaagatccccacgctgaaaccggcctttcgcgagggc
ggcacggtgacggcggccaactccagctccatttccgatggggctgccgccttgctgttg
atgcgtcgtagcgaagctcaggctcgcggactcgcaccgctggcggtcattcatgggcac
acggcctttgccgacgcgccgcacctgttccccgtagcgcccattggcgccattcgcaag
ctggtggaaaccaccgggtgggcgttgccagacgtcgacctgttcgagatcaacgaagca
ttcgccgtggtcaccctggccgccatgcaggcgctcgacttgccggcggacaaggtcaac
gtcaacggcggtgcctgcgccttgggccacccgattggcgcctctggcgcgcgcatcgtg
gtgaccttgctggcggccctgcggcaacgcaacctgcgccgtggcatcgccgcgatctgt
atcggcggcggcgaagcgacggccattgcggtggagtgcctgtattga

DBGET integrated database retrieval system