KEGG   Pseudomonas rhizosphaerae: LT40_18695Help
Entry
LT40_18695        CDS       T03339                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
prh  Pseudomonas rhizosphaerae
Pathway
prh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:prh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LT40_18695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:prh03011]
    LT40_18695
Ribosome [BR:prh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LT40_18695
  Bacteria
    LT40_18695
  Archaea
    LT40_18695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AIS19303
UniProt: A0A089YS87
Position
4173254..4173586
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEH
NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgctggcttttagcagt
aaaaaagccgcggaaatcatgaagaaagtgctggagtcggccgtagccaacgccgagcac
aacgaaggcgcagacgttgatgacctgaaggtcagcactgttttcgtcaacgaagggcgt
tcgctgaagcgcatcatgcctcgtgccaaaggccgggctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system