KEGG   Paenibacillus riograndensis: PRIO_0486Help
Entry
PRIO_0486         CDS       T03849                                 

Gene name
phaA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00071  Fatty acid degradation
pri00072  Synthesis and degradation of ketone bodies
pri00280  Valine, leucine and isoleucine degradation
pri00310  Lysine degradation
pri00362  Benzoate degradation
pri00380  Tryptophan metabolism
pri00620  Pyruvate metabolism
pri00630  Glyoxylate and dicarboxylate metabolism
pri00640  Propanoate metabolism
pri00650  Butanoate metabolism
pri00900  Terpenoid backbone biosynthesis
pri01100  Metabolic pathways
pri01110  Biosynthesis of secondary metabolites
pri01120  Microbial metabolism in diverse environments
pri01130  Biosynthesis of antibiotics
pri01200  Carbon metabolism
pri01212  Fatty acid metabolism
pri02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PRIO_0486 (phaA)
   00630 Glyoxylate and dicarboxylate metabolism
    PRIO_0486 (phaA)
   00640 Propanoate metabolism
    PRIO_0486 (phaA)
   00650 Butanoate metabolism
    PRIO_0486 (phaA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PRIO_0486 (phaA)
   00072 Synthesis and degradation of ketone bodies
    PRIO_0486 (phaA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PRIO_0486 (phaA)
   00310 Lysine degradation
    PRIO_0486 (phaA)
   00380 Tryptophan metabolism
    PRIO_0486 (phaA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PRIO_0486 (phaA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PRIO_0486 (phaA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PRIO_0486 (phaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pri04147]
    PRIO_0486 (phaA)
Enzymes [BR:pri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PRIO_0486 (phaA)
Exosome [BR:pri04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PRIO_0486 (phaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CQR51790
UniProt: A0A0E4CUB8
Position
I:complement(532224..533309)
Genome map
AA seq 361 aa AA seqDB search
MTACLQQSRLEPALIDQIYLGNVLQAGIGQNPARQAALKAGIPIDVPASTINTVCGSGLH
AVALAYNSILAEQGSVLLAGGMESMSNAPYVLKNARNGYKLGNGELIDSVVADGLTCPIN
KYHMGITAENIAAKYNISRLEQDEFAYGSQIKAREAKNKQVFAEQIVPVLTKTKKAEIWF
SEDEHVRADTSKEKLSNLKPVFKENGSVTAGNASGINDGAAAVLVMSEDKCKEHAVQPLA
YIKGYSLVGVDPAYMGMGPVKAISSLLREQGIPLEAIDLFEINEAFAAQALAVLKELGIN
PEKVNVNGGAIAIGHPVGASGARILVTLVHEMVRRSSRYGIASLCIGTGMGIAMLVENAL
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacggcatgccttcagcaaagccgcttagagcctgcattgattgatcaaatttattta
ggaaatgtccttcaagcgggcattggccaaaatcctgccagacaggcggccctaaaagcc
ggcatccctattgatgtacctgcatcaacaataaacacggtttgcggttcagggcttcat
gccgtcgctttagcttacaactctattttggcagaacaaggcagcgtcctactggctgga
ggtatggagagcatgtcgaacgccccttatgtgctaaagaatgcacgaaatggctacaag
cttggcaacggtgaattgatagacagcgtggtagccgacggccttacatgtcccatcaat
aaatatcatatgggaattaccgcagaaaacattgccgcgaaatataacatttcaagactt
gagcaggatgagtttgcctatggaagccagatcaaggccagggaagccaaaaacaagcag
gtttttgcagagcagattgttcccgttttgaccaaaaccaaaaaagcagagatttggttc
tcggaagacgaacatgtaagagcagatacaagcaaagaaaaactttctaatctaaaacct
gtatttaaggaaaacggatcagttactgccggaaatgcctcggggatcaatgatggggcg
gcggctgtacttgttatgtcggaagacaaatgcaaggagcatgcggtacaaccgttggcc
tatatcaagggttattcccttgtcggcgttgaccctgcatatatggggatgggtccggtg
aaggccatttcgtcactgcttagggaacagggaattcctcttgaggccatcgatctgttt
gagattaatgaagccttcgctgcacaagcattagcggtattgaaagagctggggatcaac
ccggagaaggtgaatgtcaacggcggcgcaatcgcgattggacatcctgtcggtgcaagc
ggagccagaatattggttacgctcgtgcatgaaatggtacggagatcttcacgttacggc
atagcctcattatgcattggaacgggtatgggaatcgcgatgctggttgagaatgcactc
atctaa

DBGET integrated database retrieval system