KEGG   Paenibacillus riograndensis: PRIO_1606Help
Entry
PRIO_1606         CDS       T03849                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00360  Phenylalanine metabolism
pri00362  Benzoate degradation
pri00622  Xylene degradation
pri01100  Metabolic pathways
pri01120  Microbial metabolism in diverse environments
pri01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    PRIO_1606
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PRIO_1606
   00622 Xylene degradation
    PRIO_1606
   00621 Dioxin degradation
    PRIO_1606
Enzymes [BR:pri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     PRIO_1606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: CQR53909
UniProt: A0A0E4CVC7
Position
I:1818553..1819512
Genome map
AA seq 319 aa AA seqDB search
MKSNKSKIVDCTIRDGGLVNNWDFSVEFVQNLYAGLNEAGVDYMEIGYKNSPKLLKGAEG
AGPWRFLNDDFLRKVIPQKGHTKLSALVDIGRVDENDILPRSESMLDLIRVACYSKDVDK
ALQLVQTFHDLGYETTINIMALSNVMENELLEAFEQIRESVVDVVYIVDSYGSLDHNDIH
YLVDKFQTHLPNKRLGVHTHNNLQLAFSNTLLASEKGVELLDASCYGMGRAAGNCPTELL
VTHLKNTRYTLRPVLDILERLMIPLREKEEWGYIIPYMITGTLDEHPRSAMALRSSEDKD
KAVEFYDKLTTPEVNFGDK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagtaataaaagcaagattgtcgattgcacgatccgcgatggaggtctggttaat
aactgggatttcagtgttgaattcgttcagaatctatatgccggcctgaatgaggctggt
gttgattatatggagatcgggtataaaaattcacctaaactgctcaaaggagcagagggt
gccgggccttggcgttttttgaatgatgattttctgagaaaagtgattccgcagaagggt
cacaccaagctgtctgcgctggtggatatcgggcgggtcgatgagaatgatattttgccc
cgcagtgaaagtatgctcgatctgatccgcgttgcctgctacagcaaagatgtggacaag
gccctgcagctggtgcagacgttccatgatctaggttatgaaaccaccattaatattatg
gccttgtcgaatgtcatggagaatgaattgctggaagcctttgaacaaatccgcgagagc
gttgtagacgttgtatatattgtggattcatatggcagcctggaccataacgacattcat
tatctggtggacaagttccaaacccacctgccgaataagcggttaggggtacatacccat
aacaatttgcagctggccttctccaacacccttctggcttccgaaaaaggtgtagagctg
cttgatgcttcctgctacgggatgggacgtgccgccggaaactgcccgactgagctgctg
gttacccatttgaagaataccaggtacacgctccggccggtactcgacatcctcgaacgg
ctgatgatccctttgcgtgaaaaggaagaatggggctacatcattccgtatatgattaca
ggcacactggatgagcatccccgctccgcaatggcgctgcgttcatcggaggacaaggac
aaagcggttgaattctatgacaagctcaccacacctgaagtgaattttggagataaataa

DBGET integrated database retrieval system