KEGG   Paenibacillus riograndensis: PRIO_3813Help
Entry
PRIO_3813         CDS       T03849                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00670  One carbon pool by folate
pri00790  Folate biosynthesis
pri01100  Metabolic pathways
Module
pri_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PRIO_3813
   00670 One carbon pool by folate
    PRIO_3813
Enzymes [BR:pri01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PRIO_3813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CQR56216
UniProt: A0A0E4HBV1
Position
I:complement(4449465..4449956)
Genome map
AA seq 163 aa AA seqDB search
MSISLIWAMAANGVIGKDNDMPWHLPRDFDYFKSQTLGKRMLMGRKTWDSLGGKPLKGRT
SIVLTRDRSFAPEGAEIVHSLEEAVAEGRRDDELMVIGGAEIYKMMLPYADKLLVTRIAQ
DFEGDTRFPEVDWSGWREISNSPGIRDEKNPYDYRFYVYERPV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcattagcctgatttgggccatggcagccaacggtgtcatcggcaaggacaatgat
atgccctggcatctgccgcgtgactttgactatttcaagtcgcagacgctgggaaagaga
atgctgatgggccgcaaaacctgggattcactgggcggcaagccgttaaaaggccgaaca
agcattgtcctcacacgagaccgcagctttgctcccgagggggctgaaattgtccactcc
ctggaagaagcggtggccgaaggccgccgggatgatgaactgatggttataggcggtgca
gagatttacaaaatgatgctgccctatgccgacaagctgctggtaacccggattgcccag
gactttgaaggggatacgaggtttccggaggtcgactggagcgggtggagagaaatctct
aacagcccgggaatccgggatgaaaagaatccgtatgattaccggttctatgtttatgaa
cgtccggtttga

DBGET integrated database retrieval system