KEGG   Paenibacillus riograndensis: PRIO_4086Help
Entry
PRIO_4086         CDS       T03849                                 

Gene name
sucD
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00020  Citrate cycle (TCA cycle)
pri00640  Propanoate metabolism
pri00660  C5-Branched dibasic acid metabolism
pri01100  Metabolic pathways
pri01110  Biosynthesis of secondary metabolites
pri01120  Microbial metabolism in diverse environments
pri01130  Biosynthesis of antibiotics
pri01200  Carbon metabolism
Module
pri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pri_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PRIO_4086 (sucD)
   00640 Propanoate metabolism
    PRIO_4086 (sucD)
   00660 C5-Branched dibasic acid metabolism
    PRIO_4086 (sucD)
Enzymes [BR:pri01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PRIO_4086 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: CQR56489
UniProt: A0A0E4CXL6
Position
I:complement(4748585..4749514)
Genome map
AA seq 309 aa AA seqDB search
MSILVDKNTKVITQGITGSTGLFHTKGALDYGTQMVGGVTPGKGGTTVNITLENGSEVSL
PVFDTVVAAKAATGATASVIYVPPAFAADSIMEAVDAGLELVICITEGIPVLDMVKVSRF
MEGRSTVLIGPNCPGVITPGECKIGIMPGYIHMPGYVGVVSRSGTLTYEAVHQLTERGIG
QSSAVGIGGDPVKGSEFIDILKLFNEDPGTKAVIMIGEIGGTAEEEAAEWIKENMTKPVV
GFIGGVTAPPGKRMGHAGAIISGGKGTASEKIAVLESCGIKVAPTPAEMGTTLVKVLEER
GILNAFTTH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcttgtagataaaaatacgaaggtaatcacgcaagggatcacgggctctacc
ggcttgttccataccaaaggagctttggattacgggacgcagatggtaggcggggttact
cccggcaaaggcggaactactgtaaacattactttggagaatggcagcgaggtcagtctg
cctgtatttgatactgtggtggcggccaaagcggctacgggtgcgacagcaagcgtaatt
tatgtcccgccggcttttgccgcagactccatcatggaggcagtggatgccggtcttgaa
ctggtgatttgtatcactgaaggaatccccgtattggatatggtgaaggtctcccgcttt
atggaagggcgttctaccgtgctgatcgggcctaactgtcctggggttatcacacccggc
gagtgcaaaataggcatcatgccggggtatattcatatgcctggttatgtgggcgtcgta
tcccgcagcggaacgctgacctatgaggcggttcatcagctcactgagcgcggaatcggg
cagtcttcagcggtcggtatcggcggtgacccggtaaaaggctcggagtttatcgatatt
ctgaagctgtttaatgaagatccgggaaccaaagccgtgatcatgatcggggaaattggc
ggtactgcggaagaagaagcggctgaatggatcaaggaaaatatgaccaagccggttgtc
ggctttattggcggagtaaccgcacctccgggcaagcggatgggtcatgccggggccatc
atatccggaggaaaagggacagcgagtgagaagatcgcggtgctggaatcctgcggaatc
aaagtggcgcctactcctgccgaaatgggcacaacccttgtcaaggtgctggaagaacgc
ggaattctgaacgcttttacgactcattga

DBGET integrated database retrieval system