KEGG   Paenibacillus riograndensis: PRIO_5603Help
Entry
PRIO_5603         CDS       T03849                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00564  Glycerophospholipid metabolism
pri01100  Metabolic pathways
pri01110  Biosynthesis of secondary metabolites
Module
pri_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PRIO_5603 (psd)
Enzymes [BR:pri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     PRIO_5603 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF3422 zf-XS
Motif
Other DBs
NCBI-ProteinID: CQR57990
UniProt: A0A0E4HDD4
Position
I:6520670..6521461
Genome map
AA seq 263 aa AA seqDB search
MVKQLLRLMTELSSHRWLSRLMGAFSHSRLSRFLIPAFIRIYHIPASEAEKHSGEYLTLN
EFFSRRLKPGMRPIASHENAVASPVDALITAMGEIHSGTIMNVKGQDYELEDLLNHSPHL
ELYKKGFFFVLYLSPTDYHRIHSPLTGRKVESEHIRGRAYPVNEFGMRHMKGVLSRNERL
ITYIAGANGEAAVVKVGAMNVSSIHYADETADAWQIGDDLAYFEFGSTVVLLLENGSFTA
RPGLTSGTKVKMGELLGTLQRPV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacaattgctgcggctgatgaccgagttgtcctcgcacagatggctttcccgg
ttgatgggggctttttcccatagcagactcagccgttttttaatcccggcatttattcgg
atttatcatattcccgcttctgaggcggagaagcattccggggaataccttacactcaat
gaatttttcagccgccgcctaaaacccggcatgcgtcctattgccagccacgagaatgcg
gtagccagcccggtggatgcgctgattaccgccatgggcgagattcactccggaacgata
atgaatgtaaaaggacaggactatgaactggaagatcttttgaaccattccccgcacctg
gagctgtacaaaaaaggctttttcttcgtgctctacttaagtccaacggattatcaccgg
attcactccccgcttaccgggcgcaaggtcgaaagtgagcatatccgcggacgggcctat
ccggtcaatgagttcggcatgagacacatgaaaggtgtgctcagccgcaatgaacggctg
attacttatatcgccggagccaacggtgaagccgccgtggtaaaagtcggcgcgatgaat
gtcagcagcatccattacgcggatgaaacggctgatgcctggcagatcggcgacgatctc
gcttatttcgaattcggctccaccgtagtactgctcctggagaacggcagcttcaccgcg
cgtccggggctgaccagcggaaccaaggtgaagatgggcgagctgctgggcacgctgcag
cgtccggtgtag

DBGET integrated database retrieval system