KEGG   Paenibacillus riograndensis: PRIO_6379Help
Entry
PRIO_6379         CDS       T03849                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00480  Glutathione metabolism
pri00590  Arachidonic acid metabolism
pri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PRIO_6379
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PRIO_6379
Enzymes [BR:pri01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PRIO_6379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CQR58726
UniProt: A0A0E4CZN3
Position
I:complement(7437094..7437570)
Genome map
AA seq 158 aa AA seqDB search
MSIYSFAGVKPSGAEVPFKDYEGKVLLIANTASKCGLTPQYGDLQKLYEQYGDKGLVVLG
FPCNQFAGQEPGTSEEAEEFCQINYGVTFPIFAKVDVNGPDASLLFQYLKGQQPGEGGSS
DIQWNFTKFLVDRSGNVVARVEPKESPESMKEQIEALL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttacagttttgcaggcgtgaagccttcgggtgcagaggtgcctttcaaggat
tatgaaggcaaggtgctgctgattgccaacacggccagcaaatgcggacttacaccacag
tacggggatttgcagaagctgtatgagcagtacggcgacaagggacttgtggtattgggt
tttccctgcaaccagtttgccggacaggagccgggcaccagtgaagaagcagaggagttc
tgccagattaattatggcgttacgttccccatttttgccaaagtggatgtgaacgggccg
gatgccagtctgctttttcaatacttgaagggccagcagccgggagaaggcgggagcagt
gacattcagtggaacttcacgaagttcctcgtcgaccggagcggcaacgtggtagcccgt
gtggaaccaaaggaatcacctgaaagcatgaaggaacagatagaagcattgctttag

DBGET integrated database retrieval system