KEGG   Providencia rustigianii: NCTC6933_02765Help
Entry
NCTC6933_02765    CDS       T06047                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
prj  Providencia rustigianii
Pathway
prj00471  D-Glutamine and D-glutamate metabolism
prj00550  Peptidoglycan biosynthesis
prj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NCTC6933_02765 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCTC6933_02765 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prj01011]
    NCTC6933_02765 (murD)
Enzymes [BR:prj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     NCTC6933_02765 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:prj01011]
 Precursor biosynthesis
  Amino acid ligase
   NCTC6933_02765 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: VEB71996
Position
1:complement(2737173..2738498)
Genome map
AA seq 441 aa AA seqDB search
MVGLQAQQYQGKNVVIIGLGLTGLSCVQFFLTRGVVPRVMDTRAVPPGIDKLPDNVICHS
GSLNDEWLLQADLIVASPGIALATKQLQLAANKGIEIVGDIELFCREVDAPIVAITGSNG
KSTVTSLVGEMAKAAGISVGVGGNIGIPALSLLNQGHSLYVLELSSFQLETTSSLQAAAA
TVLNISEDHMDRYPLGLEQYRAAKLRIYDNAQHCIVNAQDVLTLPTDHRLNQCTSFGLNN
GDYYFDTQKRVLIAKGETVLDASEMHLTGQHNYMNALAALALADTVGIPREASIKVLKEY
AGLVHRFQLVLFNNGVRWINDSKATNVGSTEAALNGLHVDGTIYLLLGGDGKSADFSPLK
NYISADNYRLYCFGRDGKQLAELAPEKSVLTETMEQSLRQIAPLLKTGDMVLLSPACASL
DQFKSFEQRGDIFAQLAKELG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggttggtttacaggctcagcagtatcagggtaaaaacgttgtcattataggcttaggg
ttaactggcctatcgtgtgttcaatttttcctcacgcgtggtgttgttcctcgtgtgatg
gatacccgcgctgtgccgcccggcattgataaacttcccgataatgtgatttgccatagt
ggaagtttgaatgatgaatggctgctacaagccgacttaattgtggcgagtccaggtatt
gcactggcaactaagcaactacaattagccgccaataaaggcattgaaattgttggtgat
attgaactgttttgccgtgaggtagatgcacctatcgtagcgattaccggttcaaatggt
aaaagtactgtgacctctttagttggcgaaatggctaaagccgctggcatttctgtcggt
gttggcggaaatattggtattccagcgttatcactgttaaatcaaggtcatagtttgtat
gtgttagagctgtctagcttccaattggagacgacctctagtttacaagcagctgctgcg
acagtattgaatatcagtgaagatcatatggatcgctatccactagggttggaacagtat
cgcgcggctaaattacgaatttatgacaatgcacaacattgtattgttaatgctcaggat
gtcttaacgctccctactgaccatcggctcaatcaatgtactagctttgggttaaataat
ggcgattactactttgatactcaaaagcgagttttgatagcgaaaggggaaacggtgtta
gatgcctcagaaatgcatttaactgggcagcataactatatgaatgcactagctgcatta
gctttagcggatacggttggtattcctcgtgaagctagcatcaaagtattaaaagagtat
gcgggcttagttcatcgcttccaattagtattatttaataatggagttcgttggattaac
gattctaaagccaccaacgtaggtagcactgaagctgcattaaatggtttacatgtggat
ggtactatttatctactgctgggtggtgatggtaaatcggcagatttttcaccactgaaa
aattatatttcggcagataattatcgcctgtactgctttggtcgtgatggtaagcagctt
gcggaattagcgccagaaaaatcagtactcactgagacgatggagcaaagtctgcgccaa
attgcacctttattgaaaacaggggatatggtgctgttatccccagcttgtgcgagtttg
gatcagtttaaaagctttgaacagcgtggcgatatctttgctcagttagctaaggagtta
ggttaa

DBGET integrated database retrieval system