KEGG   Providencia rustigianii: NCTC6933_03362Help
Entry
NCTC6933_03362    CDS       T06047                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
prj  Providencia rustigianii
Pathway
prj00260  Glycine, serine and threonine metabolism
prj01100  Metabolic pathways
prj01110  Biosynthesis of secondary metabolites
prj01120  Microbial metabolism in diverse environments
prj01130  Biosynthesis of antibiotics
prj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:prj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCTC6933_03362 (ltaA)
Enzymes [BR:prj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     NCTC6933_03362 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: VEB75089
Position
1:3316399..3317421
Genome map
AA seq 340 aa AA seqDB search
MITIDLRSDTLTRINKEDLNNINYNYISDDCYNEDIYVKELESYISQLFNKESALFMPSG
TMSNQIGLKVLSSLGDEVITEVGYHICFFESAQTSILSGLIINNVKTKNGILTEKDVIQA
INNKARWSNLYASPKIIAIESSISTYGGITFPLAEIKKLKQLCIEKNMSLFLDGARVLNS
CISLGIPPQEYVKDVDLLNICLSKGIGAPFGSVLVGEKHHIEKAKRFRKWYGGALHQSGL
LAAIALNKLEHYESRLRTDHKNAVHLASIASKYFQLAYPVETNIVMVKTQDANNLVHSLK
SHGILSTAWTSDIVRFVTSSNISESMIMQIDSLFQKIEFF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgataactattgatttaagaagtgatacgctgacaagaataaataaagaagacttgaat
aatataaattacaattatattagtgatgattgttacaatgaagatatttacgtgaaagaa
ttagaatcttatatctctcaactttttaataaagaaagtgccttatttatgccatccggt
acgatgagcaatcaaattggtttaaaagttttatcctctttaggcgatgaagttattact
gaagttggctaccatatttgtttttttgaatcagcccaaacttcgatactcagtggttta
attattaataatgttaaaactaaaaatggtattttaactgaaaaagacgttattcaagct
attaataataaggcccgttggtccaatttatacgcctcgcccaaaatcatagcgatagaa
agcagcataagcacctacggtggaatcacattcccattagccgaaataaaaaaactcaag
cagctatgcattgaaaaaaatatgtcactatttttggatggtgcgcgagtattaaatagc
tgcatctctcttggtatccctccacaggaatatgttaaagatgttgaccttctcaatatc
tgcttgtcaaaaggcattggggcgccatttgggtcagtgctagtgggcgaaaaacatcat
atagaaaaagcgaaacgcttcagaaagtggtacggcggagcattacaccaatcagggtta
ctggcggcgattgccttaaataaacttgagcattatgaatcaaggctacgcactgaccat
aaaaatgcggttcatcttgcgtctattgcatcaaagtattttcaattagcttaccctgtg
gaaaccaatattgtcatggtaaaaactcaagatgcaaataatcttgtgcactcactaaaa
agccatggaatattatcgactgcttggacatccgatattgtacgttttgttactagcagt
aatatttcagagtctatgataatgcagatagactccctatttcaaaaaatagaatttttt
taa

DBGET integrated database retrieval system