KEGG   Providencia rustigianii: NCTC6933_03676Help
Entry
NCTC6933_03676    CDS       T06047                                 

Gene name
mqo
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
prj  Providencia rustigianii
Pathway
prj00020  Citrate cycle (TCA cycle)
prj00620  Pyruvate metabolism
prj01100  Metabolic pathways
prj01110  Biosynthesis of secondary metabolites
prj01120  Microbial metabolism in diverse environments
prj01130  Biosynthesis of antibiotics
prj01200  Carbon metabolism
Module
prj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:prj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCTC6933_03676 (mqo)
   00620 Pyruvate metabolism
    NCTC6933_03676 (mqo)
Enzymes [BR:prj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     NCTC6933_03676 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: VEB75989
Position
1:3643273..3644766
Genome map
AA seq 497 aa AA seqDB search
MTKPIAENIDVALIGAGIMSATLGTFLKELEPNLNIAVFERLNDCAQESSHPWNNAGTGH
AANCEMNYTPPNPDGTVDISKALEVNTEFDLSRQLWSYLVTKGKIKNPRDFIHPCPHMSF
VSGADNIKFLQQRFRQMSAHHCYHNMEYSDDLKQIDEWAPLVVEGRDPDEKIAVTRVVTG
ADVDYGALTHLLMAQLSEQSGFSIHYKHEVIDVTQTPDGRWNIEIKNLVTHEKTITSAKF
VFVGAGGRAIELLQKSEIPEGKGYGGFPVSGIWLRCDDEQIAARHHAKVYGKADKGSPPM
SVPHLDTRIIGGKRSLLFGPYAGFSSKFLKHGSYLDLFDSIRLNNIEPMLEIAKDDWSLA
EYLVGQVLQTSAHQFSMLQKFYPDAQREDWKEVVAGQRVQIIKPDPVKKGVLEFGTELIT
SADKSFTVLMGASPGASTAAFIALNILKTCFDDQLESDGWKARLKEIIPTYGIDLKQDAK
ACLDIRTATAKVLQLDN
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacccattgcagaaaatattgatgttgccctaattggggcagggatcatgagt
gcaacactcggtacctttctaaaagaacttgaacctaatttaaatattgctgtatttgaa
agacttaacgattgcgcacaagaaagctctcatccgtggaataacgcaggaacagggcat
gctgccaactgcgaaatgaactataccccaccaaacccagatggcacggtagatattagt
aaagcgctggaagttaataccgagttcgacctatctcgccaattatggtcatacttagtc
actaagggaaaaattaaaaatccacgggattttatccacccttgcccgcacatgagtttt
gtttctggtgccgataatattaaatttttgcagcaacgtttccgtcaaatgtcagcccat
cactgctaccacaatatggaatacagtgatgacctgaagcagattgatgaatgggcacca
ttagttgttgaaggtcgtgatcctgatgaaaaaatcgcagtaacccgtgttgttacaggt
gctgatgtggattatggtgcattaactcacttgttaatggcgcagctcagtgagcaaagt
gggttctcaattcactataaacatgaagttattgatgtgacgcagactcctgatgggcgt
tggaatatcgaaattaaaaatctcgtgactcacgaaaaaaccatcacatccgcaaaattt
gtgtttgtcggggctggtggtcgagcgattgaattactgcaaaaatccgaaattcctgaa
ggtaaaggctacggtggattcccagtcagtggaatttggttgcgctgcgatgatgaacaa
attgctgcacgccatcatgcaaaagtgtacggcaaagcagataaaggttctccacccatg
tctgtccctcacttagatacccgcattattggtggaaaacgttccttattgtttggccca
tatgccggtttttccagtaagtttctaaaacacggttcttatctggatctgtttgactcc
atcagactgaacaatattgagccgatgttagaaatcgctaaagatgactggtctctggcg
gaatatttagttgggcaagtgctgcaaacttctgctcatcaattctctatgctgcaaaaa
ttctacccagatgcccagcgtgaagattggaaagaagtggtcgcaggtcaacgagtacaa
atcatcaaacctgaccctgtgaagaaaggcgttctggaatttggtactgagctaatcacc
agtgcagataaatcctttactgtcttgatgggcgcatctcctggtgcatcaacagctgcc
tttatcgcgttgaatatcttgaaaacctgcttcgatgatcaactcgaatctgatggttgg
aaagcccgcttgaaagagatcattccaacctatggaatcgatttaaaacaagacgcaaaa
gcctgtttagatattcgtaccgcaacagcaaaagtgttacagctggataattaa

DBGET integrated database retrieval system