KEGG   Providencia rustigianii: NCTC6933_03958
Entry
NCTC6933_03958    CDS       T06047                                 

Gene name
fdhE
Definition
(GenBank) formate dehydrogenase accessory protein FdhE
  KO
K02380  FdhE protein
Organism
prj  Providencia rustigianii
Brite
KEGG Orthology (KO) [BR:prj00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    NCTC6933_03958 (fdhE)
SSDB
Motif
Pfam: FdhE Elf1 zf-3CxxC Stc1 HscB_4_cys
Other DBs
NCBI-ProteinID: VEB76731
Position
1:complement(3899141..3900076)
AA seq 311 aa
MGIRIVPKEELGQERLKEKGIGFIPPVLFPNLKNLYQRRAERLKELGVGEHPFADYLNFA
AEVATAQNNAQHDNPLEMDMAEVLARSTVTNTPPLDAKTFPRTNHWHKLLSSIIAELMPI
VPDSVRTALENLEKASESELEEMATALLNEHFEKVPADKSMFIWAALSVYWAQMAANIPG
KARAEHGDHRHFCPVCNSMPVSSIVQIGSSQGLRYLHCTLCETEWHMVRVKCSNCEQTRD
LNYWSLDDENAAVKAESCGDCGSYLKVLYQEKESKVEPVADDLASIILDARMEEEGFARS
SINPFLFPGEK
NT seq 936 nt   +upstreamnt  +downstreamnt
atgggtattcgtatcgtccctaaagaagaattaggtcaagaaagattgaaagaaaaagga
attgggtttattccacctgttctgttcccgaatttaaaaaacctttatcaacgtcgcgcg
gaacgattaaaagaacttggcgtgggtgaacatccttttgcagattatctgaattttgct
gcggaagtggcaacggcacaaaataatgcgcagcatgacaacccattagaaatggacatg
gctgaagtactggcgcgttcaaccgtaacgaatacgccaccgttagatgcaaaaacattt
cctcgtacgaatcattggcacaaattattaagctcgatcatcgcagagttaatgccaatc
gtccctgactcagtgcgtacagcattagaaaatctagaaaaagcctctgaatctgaattg
gaagagatggcaacggcgttgctaaatgaacattttgaaaaagtcccagcagacaaatca
atgtttatttgggcggcattatcggtttattgggcacaaatggcagcaaacattccaggt
aaagcccgtgctgaacatggtgaccatcgtcatttttgcccagtatgtaacagcatgccg
gtctctagtattgttcaaattggttctagccaaggcttacgttatttacactgcaccttg
tgtgaaaccgagtggcatatggtacgtgtgaaatgcagtaactgcgagcaaactcgtgac
ctcaattattggtcattagatgatgaaaatgcagctgtaaaagcagaaagttgtggcgat
tgtggcagctatcttaaagtgctataccaagaaaaagagtctaaagttgaaccggtcgcc
gatgatttagcgtcgattattttagatgcacgtatggaagaagaaggttttgctcgtagc
agcattaacccatttttgtttcccggcgaaaaataa

DBGET integrated database retrieval system