KEGG   Providencia rustigianii: NCTC6933_03959
Entry
NCTC6933_03959    CDS       T06047                                 

Gene name
fdoI
Definition
(GenBank) Formate dehydrogenase-O subunit gamma
  KO
K00127  formate dehydrogenase subunit gamma
Organism
prj  Providencia rustigianii
Pathway
prj00630  Glyoxylate and dicarboxylate metabolism
prj00680  Methane metabolism
prj01100  Metabolic pathways
prj01120  Microbial metabolism in diverse environments
prj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC6933_03959 (fdoI)
  09102 Energy metabolism
   00680 Methane metabolism
    NCTC6933_03959 (fdoI)
SSDB
Motif
Pfam: Ni_hydr_CYTB DUF4405 DBD_Tnp_Hermes PepSY_TM
Other DBs
NCBI-ProteinID: VEB76733
Position
1:complement(3900473..3901129)
AA seq 218 aa
MMPDDNDKIIRHKPIERINHWAVVICFLFTAISGLGFFFPSLNWFMNILGTPQLSRILHP
FVGTAMFLLFVFMFFRYFHHNFINKDDIKWAKNIGKVLKNEEAGDVGQYNLGQKGVYWVV
TICLLALVVSGVIMWRPFFADYFPIPVYRAAIIIHSLSAIGLILMIIVHAYAAIWVKGSV
RAMVEGWVTRGWARKHHPRWYREIVAKEKQQQEQQDKN
NT seq 657 nt   +upstreamnt  +downstreamnt
atgatgccagatgataatgacaaaattattcgtcataagccgattgaaaggatcaatcat
tgggcggttgtgatttgcttcttgttcactgctatcagcggattgggctttttcttccca
tccttgaactggttcatgaacattttaggcacgccacaattgtctcgaattttgcatccc
tttgtgggcacggcgatgttcttgctattcgtattcatgttcttccgttatttccaccat
aacttcatcaataaagatgatattaagtgggcaaaaaatatcggtaaggtactgaaaaac
gaagaagctggcgacgttggtcaatataacctcggtcaaaaaggggtgtattgggttgtc
actatctgcttactggctttggtcgtgagcggcgtgattatgtggcgtccattctttgct
gattatttcccaattccagtgtaccgtgcagcgattatcattcactcactgtcggcgatt
ggtttgattctgatgattatcgtacatgcctatgcggcaatctgggtgaaaggctcagtt
cgtgcgatggtggaaggatgggtaacccgtggttgggcgagaaagcaccacccacgttgg
taccgtgaaattgttgccaaagagaaacagcaacaagagcagcaagataaaaactaa

DBGET integrated database retrieval system