KEGG   Providencia rustigianii: NCTC6933_03960
Entry
NCTC6933_03960    CDS       T06047                                 

Gene name
fdoH_2
Definition
(GenBank) Formate dehydrogenase-O subunit beta
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
prj  Providencia rustigianii
Pathway
prj00630  Glyoxylate and dicarboxylate metabolism
prj00680  Methane metabolism
prj01100  Metabolic pathways
prj01120  Microbial metabolism in diverse environments
prj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:prj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCTC6933_03960 (fdoH_2)
  09102 Energy metabolism
   00680 Methane metabolism
    NCTC6933_03960 (fdoH_2)
SSDB
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_9 Fer4_10 Fer4_21 Fer4_6 Fer4 Fer4_2 Fer4_4 Fer4_16 Fer4_3 Fer4_22 Fer4_8 Fer4_17 SfsA_N Fer4_13 Fer4_20 Fer4_15
Other DBs
NCBI-ProteinID: VEB76736
Position
1:complement(3901126..3902070)
AA seq 314 aa
MSMQSQDIIRRSATNSLTPAPQVRDYKEEVAKLIDVTTCIGCKACQVACSEWNDIRDKIG
TNVGVYDNPTDLTAKSWTVMRFSEVEENDRFEWLIRKDGCMHCADPGCLKACPAEGAIVQ
YKNGIVDFQSEHCIGCGYCIAGCPFDVPRINKDDNRAYKCTLCVDRVEVGQEPACVKTCP
TGAIHFGSKEDMINMAGDRVEELKTRGYANAGLYDPEGVGGTHVMYVLHHADKPQLYHGL
PENPTISPTVTFWKGIWKPMAAVGFAATFAAAIFHYVGIGPNRVSKKDEEEALEDLHNAT
SSDSSKSKEGEDQK
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtcaatgcaatcacaggacattattcgtcgctctgccaccaattccctgactcccgca
cctcaggtgcgggattataaggaagaagttgcaaagctaatcgacgtcacaacctgtatt
ggctgtaaagcttgtcaggttgcgtgttccgaatggaacgatattcgcgacaaaatcggt
actaacgttggggtgtatgataacccgacggatttaaccgccaagtcatggacagttatg
cgtttctctgaagttgaagagaacgatagatttgaatggctgattcgtaaagatggctgt
atgcactgtgctgatcctggctgcctgaaagcatgtccagcagaaggcgcaatcgttcag
tacaaaaatggtatcgttgatttccaatcagaacactgtattggttgtggttactgtatc
gcgggttgcccgttcgacgtaccacgtatcaacaaggacgataaccgtgcatacaaatgt
acgctgtgtgttgaccgtgttgaagtgggtcaagaacctgcgtgtgtgaaaacatgccca
acaggtgcgattcactttggtagcaaagaagacatgattaacatggcaggtgaccgtgtt
gaagagctgaaaactcgcggttacgcaaacgcaggtttatacgatcctgaaggtgtgggc
ggtacgcacgttatgtacgttttacaccatgcggataaacctcagctgtatcatgggcta
ccagaaaatccgaccatcagcccaacagtcaccttctggaaaggtatctggaagccgatg
gcagcggttggttttgctgcaacatttgcggcggccatcttccactatgtgggtattggt
ccgaaccgcgtctccaaaaaagatgaagaagaagctttagaagatttgcataacgcaacg
tcatctgactcttcaaaatcaaaagaaggggaggatcagaaatga

DBGET integrated database retrieval system