KEGG   Providencia rustigianii: NCTC6933_03962
Entry
NCTC6933_03962    CDS       T06047                                 

Definition
(GenBank) formate dehydrogenase accessory protein
  KO
K02379  FdhD protein
Organism
prj  Providencia rustigianii
Brite
KEGG Orthology (KO) [BR:prj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    NCTC6933_03962
SSDB
Motif
Pfam: FdhD-NarQ
Other DBs
NCBI-ProteinID: VEB76739
Position
1:3905305..3906135
AA seq 276 aa
MYETNTTNNPKLSKMIGVNHTTVQQKNNLGLLVNDYVAEEIPVALVYNGISHVVMMATPK
DLSDFAVGFSLSEGIIQSRDEIRGIDIVQGCHRGIEVQIELSNRRFMELKERRRNLTGRT
GCGICGTEQLDEIFKPLTPLPFTQTFSLSYLDNALNELKKVQEIGALTGCTHAAAWISPE
GLLVGGCEDVGRHVALDKLLGMKSRSDWQQGAILVSSRASYEMVQKAASCGAEILFAVSA
ATALAIEVAEKANLTLVGFCRQGKATVFTHPSRVRD
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtatgaaacaaatactacaaataaccccaaattatctaaaatgatcggcgttaatcac
acaaccgtgcaacaaaaaaacaacctaggattattggttaatgattatgttgcagaagaa
attcctgttgcacttgtatacaacggaatatctcacgtcgtaatgatggcaacgccaaaa
gatttgagtgattttgctgtcggattttcattatccgaaggaattatacaatcccgagat
gaaatccgtggaattgatattgtacagggctgccatcgaggcattgaagtacagattgaa
ttatccaaccgccgttttatggaactcaaagagcgcagacgtaacctaacgggccgtact
ggctgtggtatttgtggcacagaacagctcgacgagattttcaaacctctcacaccgctg
ccattcactcaaaccttctctctatcatacctcgataatgcgcttaatgaattaaaaaaa
gtccaagaaattggggcattaacaggttgtacccatgctgccgcgtggatttcccctgaa
ggtttattagtcggtggttgtgaagatgtgggtcgccatgtggcgcttgataagctattg
ggcatgaaaagccgctcagattggcagcaaggggcaattttagtttctagccgtgccagt
tatgaaatggttcaaaaagcggctagctgtggtgcggagattttatttgcggtctctgct
gcaacagctcttgccattgaggtcgccgaaaaagccaatttgacgctggtcggattctgc
cgccaaggtaaagcgacggtgtttactcatccgagtcgggtgagggattaa

DBGET integrated database retrieval system