KEGG   Providencia rustigianii: NCTC6933_03963
Entry
NCTC6933_03963    CDS       T06047                                 

Definition
(GenBank) Uncharacterised protein
Organism
prj  Providencia rustigianii
SSDB
Motif
Pfam: DUF1700
Other DBs
NCBI-ProteinID: VEB76741
Position
1:complement(3906173..3906493)
AA seq 106 aa
MKWIALITLGFVVMVVWNVYSSKKRREYLLHKYGDETVVNMIMKRTFWIGQTSEQLLDSL
GRPLDISSKVMKTRYREIRKYNKTGSNRYGLRITLDDGFVQGWDEK
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaaatggatagcattaattactttaggttttgtagtgatggttgtttggaatgtgtac
tcatctaaaaaaagaagggaatatttgttgcataagtatggtgacgaaaccgtagttaat
atgattatgaaacgtactttttggatagggcaaacctctgaacaattattggattcttta
gggcgcccactagatatctcttctaaagtaatgaagacaagatatagagagatacggaaa
tataataaaaccggatcaaatagatatgggctgcgcattaccttggatgatggttttgtt
caagggtgggatgagaaatag

DBGET integrated database retrieval system