KEGG   Providencia rustigianii: NCTC6933_03964
Entry
NCTC6933_03964    CDS       T06047                                 

Definition
(GenBank) Uncharacterised protein
Organism
prj  Providencia rustigianii
SSDB
Motif
Pfam: DUF4885
Other DBs
NCBI-ProteinID: VEB76743
Position
1:3907033..3907605
AA seq 190 aa
MSINFVLTSQDMNQEKKELIKKILKVDDASIQDTLNKIAKASFLEYLSMITETGMPNRAD
EIRQNRLLLLIQHYFGDNLPTEADISTIFQLTQSQSKTLLANTVSRFKHTLDSSLINTMK
RVIESAENSDELYLVVINSDVVKDELNKLITQRKPTFKPITKKKGSASQFEISEDSYDLL
CAELNLNETE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgagcattaacttcgttctaacatcccaagatatgaaccaagaaaaaaaagaattaatt
aaaaaaatattaaaagttgatgatgcaagcattcaagatacattgaataaaattgcaaaa
gcttcttttttagaatacctatccatgataactgagacagggatgccaaatcgtgctgat
gaaattagacagaatagattgctccttttaattcaacactatttcggtgataaccttcct
actgaagctgacatatcaactatttttcaattaacacagagccaaagtaaaactctactt
gcgaatacagtatctagatttaaacatacgttagactcctcattaatcaatacaatgaaa
cgagtcattgaatctgccgaaaattcagatgaattatacttagtagtaattaattctgat
gttgtaaaagatgagctaaacaaactaatcactcaaagaaaacctacatttaagcctatc
accaagaaaaaaggaagcgctagtcaatttgaaattagtgaagactcctatgatttactt
tgtgcggagttaaatttaaatgaaactgagtga

DBGET integrated database retrieval system