KEGG   Providencia rustigianii: NCTC6933_03965
Entry
NCTC6933_03965    CDS       T06047                                 

Definition
(GenBank) Uncharacterised protein
Organism
prj  Providencia rustigianii
SSDB
Motif
Pfam: DUF1385
Other DBs
NCBI-ProteinID: VEB76745
Position
1:3907592..3907975
AA seq 127 aa
MKLSDIIAISGLLLTLITFLFNLAWPKINDSLTQDESIAGEKARANCKTKIRKTLWSIVI
PIFISFLALFYINLPTVIKIFISSKLSLWSFNIESTLYVMVEYALLAFIIFNFYLIIKLC
KKIKKFK
NT seq 384 nt   +upstreamnt  +downstreamnt
atgaaactgagtgatattatagccatatctgggttattacttacattgataacattttta
tttaatttggcatggccaaaaataaatgattcattaactcaagatgagtcaatcgctggc
gaaaaagccagggcaaattgtaaaactaaaattcgtaaaacattatggtcaatcgtcatt
cctatatttatatcatttttagctttattttatattaatcttcctactgtcataaaaata
tttatctctagtaaattatcactttggagtttcaacattgaaagtaccctttatgttatg
gtcgaatatgctcttttagcattcataattttcaatttttacttaattataaagctatgc
aagaaaataaaaaaattcaagtaa

DBGET integrated database retrieval system