KEGG   Providencia rustigianii: NCTC6933_03966
Entry
NCTC6933_03966    CDS       T06047                                 

Definition
(GenBank) DNA-damage-inducible protein D
  KO
K14623  DNA-damage-inducible protein D
Organism
prj  Providencia rustigianii
Brite
KEGG Orthology (KO) [BR:prj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:prj03400]
    NCTC6933_03966
DNA repair and recombination proteins [BR:prj03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    NCTC6933_03966
SSDB
Motif
Pfam: Bro-N
Other DBs
NCBI-ProteinID: VEB76747
Position
1:complement(3908133..3908993)
AA seq 286 aa
MEQQQIQALTMAFEDHAQQIENGVEYWLARDLQHLLGYGKWDNFVSVISKAKTACEISGH
AISDHFADVGKMVELGSGSHREIDDIMLTRYACYLVAQNGDPRKQEIAFAQTYFAMQTRK
AELIELRLLEAERVLARQKLSATEKELSSIIFEQTGGNQNFALIRSKGDMALFGKNTQAM
KTQWEVPDNRPLADFAPTIVLKAKDFATEITIHNARTQQMSREEQISNEHVTNNQAVRQT
LISRGIHPEQLPPAEDVKKVERRLASADKKLLKNPEMLGDVDETND
NT seq 861 nt   +upstreamnt  +downstreamnt
atggaacaacagcaaattcaagcactcacaatggcttttgaagaccatgctcagcaaata
gaaaatggggttgaatattggctggcgagagatctacagcatctcttaggctatggaaaa
tgggataattttgttagtgtaatatcaaaggctaaaacagcatgtgaaattagtggtcat
gctatttcagaccattttgctgacgtcgggaaaatggttgagctaggttctggtagccac
cgtgaaatagatgatattatgttaacccgttatgcctgctatctggttgctcagaacggt
gatcctcgtaagcaagaaattgcgttcgcacaaacttactttgcaatgcaaactcgtaaa
gcagagttaatagagctgcgtttacttgaggctgaacgggtgctggcacggcagaaactt
tctgcaacagaaaaagaattatctagcattatctttgaacaaacgggaggaaaccaaaac
tttgcattgattcgtagcaaaggtgacatggctttatttggtaaaaatacccaagcaatg
aaaacccaatgggaggtgccagataatcgtccactagctgattttgcgccaacgattgtc
ctcaaagccaaagattttgctactgaaattactattcataatgctcgtacgcaacaaatg
agtcgcgaggagcaaatatctaatgagcatgtaaccaacaatcaagcagtgcgccaaacg
ttaatcagtcgaggtattcacccagaacaattaccacctgcagaagatgtgaagaaggta
gaacggcgtttagcatccgcagataaaaagttacttaagaacccagagatgcttggtgat
gtggatgaaaccaatgactaa

DBGET integrated database retrieval system