KEGG   Providencia rustigianii: NCTC6933_03967
Entry
NCTC6933_03967    CDS       T06047                                 

Gene name
mnmE_1
Definition
(GenBank) tRNA modification GTPase MnmE
Organism
prj  Providencia rustigianii
SSDB
Motif
Pfam: MnmE_helical
Other DBs
NCBI-ProteinID: VEB76750
Position
1:complement(3909170..3909400)
AA seq 76 aa
MAIRRGGFLARRRHLQALNNAATHLAQGYDQLVNARSGELLAEELRLAQLELSEITGEFT
SDDLLGRIFSSFCIGK
NT seq 231 nt   +upstreamnt  +downstreamnt
gtggcaatacggagggggggcttcttagcacgccgccgtcacttacaagcactgaataat
gccgcaacccacctcgcacaaggttatgaccagttagtgaatgctcgctccggtgagtta
ttggctgaagagttacgcttagctcagctcgaactcagcgagatcacgggcgaatttacg
tccgatgatttgttagggcgtattttctcgagtttctgtattgggaagtga

DBGET integrated database retrieval system