KEGG   Providencia rustigianii: NCTC6933_03968
Entry
NCTC6933_03968    CDS       T06047                                 

Gene name
mnmE_2
Definition
(GenBank) tRNA modification GTPase MnmE
  KO
K03650  tRNA modification GTPase [EC:3.6.-.-]
Organism
prj  Providencia rustigianii
Brite
KEGG Orthology (KO) [BR:prj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:prj03016]
    NCTC6933_03968 (mnmE_2)
Enzymes [BR:prj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     NCTC6933_03968 (mnmE_2)
Transfer RNA biogenesis [BR:prj03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    NCTC6933_03968 (mnmE_2)
 Prokaryotic type
   Methyltransferases
    NCTC6933_03968 (mnmE_2)
SSDB
Motif
Pfam: MnmE_helical MMR_HSR1 FeoB_N RsgA_GTPase Dynamin_N AIG1 ABC_tran Roc Ras Gtr1_RagA Arf AAA_28 GTP_EFTU SRPRB AAA_24 AAA_18 AAA_29
Other DBs
NCBI-ProteinID: VEB76754
Position
1:complement(3909342..3910238)
AA seq 298 aa
MAQFVLRIRASFSERAFLNDKLDLAQAEAIADLIDASSEQAARSAMNSLQGAFSSHIHQL
VEALTHLRIYVEAAIDFPDEEIDFLSDGKIEAKLNEVVDDLEQVRSQARQGSLLREGMKV
VIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLREASD
EVERIGIERAWNEIEQADRVLFMVDSTTTDATEPQEIWPEFMARLPETLPVTVIRNKADK
TGESIEFVADVRYPLIRLSAREEKGIDLLRDHLKETMGFSGNTEGGLLSTPPSLTSTE
NT seq 897 nt   +upstreamnt  +downstreamnt
ttggcgcaattcgtattgcgaatccgggcgagtttttctgagcgcgcatttttaaatgac
aaactggatttggcacaggccgaagctatcgccgatttgattgatgccagctctgaacaa
gcagctcgttctgcaatgaactctttgcaaggggctttttcatcccatatccaccaatta
gtggaagcactcactcacttgcgtatctatgtcgaggctgccattgattttcctgatgag
gaaattgatttcctgtctgacggcaaaattgaagccaaactgaatgaagtggttgatgat
ttggagcaggttcgctctcaagctcgacaaggcagtttactgcgtgaaggaatgaaagtg
gtgattgccggtcgtccaaatgcgggtaaatccagcttgttgaatgcattggcgggacgt
gaagcggcgattgtcaccgatattgcaggaaccactcgtgacgtactgcgtgagcatatt
catatcgacggtatgccactgcatattattgataccgcaggcttacgcgaagccagtgat
gaggttgagcgcatcggtatagaacgcgcttggaacgagattgaacaagctgaccgtgta
ttatttatggtggatagtacgacgacagacgccaccgagccgcaagaaatttggcctgaa
tttatggcgcgcctaccagaaacgttgccagttactgtcattcgtaataaagcggataaa
accggagagtcgattgagtttgtcgcagatgtgcgttacccattaatccggttatctgct
cgcgaagagaaaggcatcgatttgctgcgcgatcatctcaaagaaaccatgggttttagt
ggcaatacggagggggggcttcttagcacgccgccgtcacttacaagcactgaataa

DBGET integrated database retrieval system