KEGG   Providencia rustigianii: NCTC6933_03969
Entry
NCTC6933_03969    CDS       T06047                                 

Gene name
mnmE_3
Definition
(GenBank) tRNA modification GTPase MnmE
Organism
prj  Providencia rustigianii
SSDB
Motif
Pfam: TrmE_N
Other DBs
NCBI-ProteinID: VEB76756
Position
1:complement(3910198..3910536)
AA seq 112 aa
MQINDTIVAQATPPGRGGVGILRVSGPKAALVAETVLGKLPKPRYAEYLPFRDVDGSVLD
QGIAIYFPGPNSFTGEDVLELQGHGGPVILDLLLRRILTIGAIRIANPGEFF
NT seq 339 nt   +upstreamnt  +downstreamnt
atgcaaatcaacgatactatcgtcgcacaggcaacacctcccggtcgtggtggagtggga
attttacgtgtatccggtccaaaggcagccttagtggctgaaacggtacttggaaagtta
ccaaagccgcgttatgccgagtatttgccatttcgtgatgtggatggctctgttcttgac
caagggattgcaatttatttcccaggaccgaattctttcacgggtgaagatgttcttgaa
ttacaagggcacggtggtccggttatcctcgatttactactcagaagaattttgacgatt
ggcgcaattcgtattgcgaatccgggcgagtttttctga

DBGET integrated database retrieval system