KEGG   Providencia rustigianii: NCTC6933_03970
Entry
NCTC6933_03970    CDS       T06047                                 

Gene name
yidC
Definition
(GenBank) Oxa1Ec
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
prj  Providencia rustigianii
Pathway
prj02024  Quorum sensing
prj03060  Protein export
prj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:prj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NCTC6933_03970 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NCTC6933_03970 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NCTC6933_03970 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:prj03029]
    NCTC6933_03970 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:prj02044]
    NCTC6933_03970 (yidC)
Mitochondrial biogenesis [BR:prj03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    NCTC6933_03970 (yidC)
Secretion system [BR:prj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NCTC6933_03970 (yidC)
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP DUF2427
Other DBs
NCBI-ProteinID: VEB76759
Position
1:complement(3910648..3912300)
AA seq 550 aa
MDSQRNLLLIALLFVTFLVWQAWESDKVAQETKTVQTSQQKTDMPNSDGQAVTNSEQGKL
IAVKTDVLDVRINTRGGDIDEADLLAYPATLNSPDPFRLLETTPGFVYQAQSGLIGPHGP
DNPANNNGQRPLYTADSASFELQAGQDELRVPMSFTDNNGVVYQKTYILKRGKYTVEVEY
SIQNPTAQPLSLAFFGQLKQTIALPEQRDTGSNNFALHTYRGAAYSSDENNYKKYSFSDI
EDKNLSLTTKGGWVAMLQQYFATAWVPEATEQSTFYTIDLDKKSAIVGYKSEPVTIAANG
AGTYSSTLWIGPEIQSEMAEVAPHLDLTVDYGWLWFISQPLFKLLKFIHGFVGNWGIAII
VITFIVRGIMYPLTKAQYTSMAKMRLLQPKLAAMRERIGDDKQRMSQEMMAMYKAEKVNP
LGGCLPLLIQMPIFLALYYMLMGSVELRHAPFFGWIQDLSAQDPYYILPVLMGVTMFVIQ
KMSPTAVTDPMQQKIMTYMPVVFTVFFLWFPSGLVLYYIVSNLVTIIQQQIIYRGLEKRG
LHSRDKKEKK
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggattcgcaacgcaatcttctactcatcgctttgttgttcgtgacgtttttggtttgg
caggcttgggagagcgataaagttgctcaggaaaccaaaactgttcaaacttcgcaacaa
aaaacggacatgccaaacagtgatggtcaagcggtcacaaatagtgagcaaggtaagctt
attgccgttaaaactgacgtacttgatgttcgcatcaatactcgcggtggtgatattgat
gaggctgatctgttagcctatccagcaaccttgaactcaccagacccgttccgtttatta
gaaaccacaccaggttttgtttatcaggctcaaagtggtctgattggtcctcatggtcca
gacaacccagcgaacaataacggtcaacgtcctctttataccgcagactcggcaagcttt
gagctacaagcgggtcaagatgaattacgtgttccgatgtctttcaccgataacaacggt
gttgtctatcagaaaacgtatattctgaagcgcggtaaatatactgttgaagttgaatac
agtattcaaaacccaacagcacagcctctgagccttgctttcttcggtcagttaaaacag
accattgcactgccagaacagcgtgatacaggaagcaataactttgctctgcatacatac
cgtggtgcggcttattcttctgatgaaaacaactataaaaaatatagtttcagtgacatc
gaagataaaaacttaagcctgactacgaaaggcggctgggtcgcaatgttgcaacaatat
tttgcaacggcgtgggttccagaagcgacagaacaaagcactttctataccattgatctc
gataaaaaatcggctatcgttggttataagagcgagccagtcactatcgcggcgaatggt
gcaggtacttattcatcgacactgtggattggacctgaaattcagtcagaaatggcagaa
gttgctcctcacttagatttaaccgtagattacggttggttatggtttatttctcagcca
ctgttcaaactgttgaaattcattcacggttttgtgggtaactggggtattgccatcatc
gttattacctttatcgtccgtggtatcatgtacccgctgaccaaagcgcagtacacctca
atggcgaaaatgcgtttactgcaaccaaaattggctgcaatgcgtgagcgtattggtgat
gacaaacaacgtatgagccaagaaatgatggcgatgtacaaagcagaaaaagtaaaccca
ctgggtggttgtttacctctgctgattcaaatgccaatcttccttgcactttactacatg
ttgatgggttctgttgaactgcgtcatgcaccattctttggttggatccaagacttgtct
gcacaagacccgtactacatcctgccagttctgatgggtgtgacgatgtttgttatccag
aaaatgtcaccaacagctgtgactgacccaatgcagcagaagatcatgacatacatgcca
gtcgtgtttaccgtgttcttcctgtggttcccatcaggtctggttctgtactatatcgtg
agtaacttagtcaccattatccagcagcagattatttatcgtggtctggaaaaacgtggt
ctacatagtcgcgataagaaagagaaaaagtaa

DBGET integrated database retrieval system