KEGG   Providencia rustigianii: NCTC6933_03971
Entry
NCTC6933_03971    CDS       T06047                                 

Gene name
yidD
Definition
(GenBank) Putative membrane protein insertion efficiency factor
  KO
K08998  uncharacterized protein
Organism
prj  Providencia rustigianii
Brite
KEGG Orthology (KO) [BR:prj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    NCTC6933_03971 (yidD)
SSDB
Motif
Pfam: YidD
Other DBs
NCBI-ProteinID: VEB76762
Position
1:complement(3912303..3912563)
AA seq 86 aa
MASSPSLGSKILIMLIRGYQLAISPLLGPRCRFNPTCSNYGIEALRRFGMLKGSWLTAKR
VLKCHPLHAGGDDPVPPRKTDDNREL
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcgtcgtcaccgtcgcttggctcaaaaatcctgatcatgctgatcagaggctaccaa
ctggctattagcccgttgttagggcctcgctgtcgttttaatcctacgtgctctaattac
ggaattgaggcattgcgcaggtttggtatgctaaaaggtagttggttaactgctaaacgc
gtattaaaatgccaccctttacacgctggtggagatgatcctgtcccacccagaaaaact
gatgataatagagaattataa

DBGET integrated database retrieval system