KEGG   Providencia rustigianii: NCTC6933_03972
Entry
NCTC6933_03972    CDS       T06047                                 

Gene name
rpmH
Definition
(GenBank) 50S ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
prj  Providencia rustigianii
Pathway
prj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:prj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NCTC6933_03972 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:prj03011]
    NCTC6933_03972 (rpmH)
Ribosome [BR:prj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NCTC6933_03972 (rpmH)
  Bacteria
    NCTC6933_03972 (rpmH)
SSDB
Motif
Pfam: Ribosomal_L34
Other DBs
NCBI-ProteinID: VEB76765
Position
1:complement(3912905..3913048)
AA seq 47 aa
MKRTFQPSVLKRNRSHGFRARMATKNGRQVLARRRAKGRARLTVSSK
NT seq 144 nt   +upstreamnt  +downstreamnt
atgaaacgcacttttcaaccgtccgtactgaagcgcaaccgttcacacggttttcgtgct
cgtatggctacaaaaaatggtcgtcaggttctggctcgccgtcgtgctaaaggccgcgct
cgtctgaccgtttcatctaagtaa

DBGET integrated database retrieval system