KEGG   Propionibacterium sp. oral taxon 193: BCB70_06940
Entry
BCB70_06940       CDS       T04515                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
prl  Propionibacterium sp. oral taxon 193
Pathway
prl00472  D-Arginine and D-ornithine metabolism
prl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BCB70_06940
Enzymes [BR:prl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BCB70_06940
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: AOH45685
Position
complement(1480620..1482935)
AA seq 771 aa
MTIQDRCLHHKHAHECKQIDLINELVTPSEPVEPRAEQDSPDPNTKLDIKEILTDLEHYH
PRRKGWTWRNVPEEGVDMGDFHYRDMSTPLKQSVALPAAEYFENIGPQPAPVVTSEIASG
HFEDDLRRMRMAAWHGADHIMVIRTTGQSHIDGLLEGTPEGIGGVPITRKQLRASRKACD
LIEDEVGRPINFHSYVSGVAGPEVAVLFAEEGVNGAHQDPQYNLLYRNINAYRSYVDAGE
AKKVMAGAQIFQIDGAHNANATARHGWKVMPELMVQHGLNCMFSVLVGMPKDLIGLSTVP
PSAPPAPKLWYDLPYAVALRDLFSEYKMRAQQNTRYIESDLAEAIRTHTIDTLISMLTSA
DIQSTITPDEGRNLPWHHNSVRGVQTVKQTWAALDGIKKMVTINREGPLGDMARDLKERA
IGFLTEMLHVGGYFAAIEDGFFVDSAEFPERNHDGIARDGQGGIAEGTVVERGPDYLAPV
CDHFGNNNLPEDLSKPCDLIDGCTLCRPGKIVYIDELDPNDSAATRLARTRPFRDGTALR
PEAEWAGDGVVLIQMNIPASEDIAREAAVEMARKMGITDPQVCNLQVLHPAEGCFVEVKG
QATHIDVDPSKLTIPEKIELLPPDELRQYVTDHELSVVAGTVGEDEHSVGLREILDIKHG
GIEKYGVKYRYLGTSVPVEKMVDAAIESGVDAILISTIISHNDIHRTMMRKLADLATEKG
IRDKVVLIAGGTQVSREMAAETGLDATFGRGTKGIDVLDAIVRTMQAREEA
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgactatccaagaccggtgtctgcaccacaagcacgctcacgagtgcaagcagatcgac
ctcatcaacgagctagtgacgccttcggaacctgttgagccacgcgccgaacaggactcc
cccgacccgaataccaaactcgacatcaaggagatcctcaccgaccttgagcactatcat
cctcgtcgcaaaggatggacttggaggaacgtgcctgaagagggagtcgacatgggcgac
ttccactaccgggacatgtccaccccgctgaaacagagcgtggccctgcccgccgcggag
tacttcgagaacattggtccccagccggcacctgtcgtcacctccgagatcgcctccggg
catttcgaagacgacttgcgccgcatgaggatggcagcgtggcacggagctgaccacatc
atggtcatccgcaccacagggcagagccacattgacgggctgctagagggcaccccggag
ggtatcggcggtgttccgatcacccgaaaacagctgcgcgctagccgcaaggcctgcgac
ctcattgaggacgaggtgggacgccccatcaacttccactcctacgtttctggggtcgcc
ggccccgaagtggccgtgctcttcgctgaggagggggtcaatggcgctcaccaagacccg
caatataacctgctgtatcgcaatatcaacgcctaccgcagctatgttgacgccggcgag
gcgaagaaagtgatggcgggagcacagatcttccagatcgacggcgcccacaacgccaat
gccaccgcccgacacggctggaaggtcatgcctgagctcatggtccagcacggtctcaac
tgcatgttctcggtgctggtaggaatgccaaaggacctcatcggcctgtcgacggtcccg
cccagcgctcccccggctccgaaactctggtacgacctgccgtacgcggtggccttgcgc
gatctattcagcgagtacaagatgcgcgcccagcaaaacacccggtatatcgagtccgac
ctcgccgaagctattcgcacccacaccatcgacactctcatttcgatgctgaccagcgcg
gacattcagagcaccatcacccctgacgaaggccgcaacctgccctggcaccacaactcc
gtccgtggcgtccaaacggtcaaacagacctgggccgccctcgatggcatcaagaaaatg
gtgaccatcaaccgcgaggggccgctgggcgatatggcccgcgacctcaaggaaagggcc
attgggtttcttaccgagatgctccacgtcggtggctatttcgctgccatcgaggacggc
ttcttcgtcgattcggcagaattcccggagcgcaaccacgacggcatcgcccgtgacggt
caaggcgggatcgccgagggaaccgtcgtcgaacgtggccccgactacctcgccccggtc
tgcgaccatttcggtaacaacaacctacccgaggacctcagcaagccatgtgatctcatc
gacggctgcaccctgtgcaggcccgggaaaatcgtctacatcgacgagctcgaccccaac
gactcggctgccacccgtctggctcgcacccgcccgttccgcgacggaacggcgctacga
cccgaggctgagtgggccggcgacggcgtcgtcctgatacagatgaacatccccgcctct
gaagacatcgcccgcgaggcagctgtcgagatggcgcgcaaaatgggcatcactgaccct
caggtgtgcaacctgcaggtgctgcaccccgccgaaggatgtttcgtggaggtcaagggc
caggcgacccacatcgacgtcgacccgtccaaactgacgattcccgaaaagatcgagctg
cttcctcccgatgaactgcgccagtacgttaccgaccacgaactgtcggtcgtcgccggc
accgtcggcgaggacgagcacagcgtcggactgcgtgaaatcctcgacatcaagcacggt
ggcatcgagaagtatggcgtcaagtaccgctacctcggcacctcagtgccggtagaaaag
atggtcgatgcggccatcgaaagcggcgtcgacgccatcctcatctcgaccatcatcagc
cacaacgatatccatcgcacgatgatgcgcaaactggctgatctggccaccgagaagggc
atacgcgacaaagtcgtcctcatcgccggtggtacccaggtgagccgagagatggccgcc
gagactggtctcgacgccaccttcggacgtggcaccaagggtattgacgtcctcgacgcc
atcgtccgtaccatgcaggcccgcgaggaagcctga

DBGET integrated database retrieval system