KEGG   Propionibacterium sp. oral taxon 193: BCB70_06945
Entry
BCB70_06945       CDS       T04515                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
prl  Propionibacterium sp. oral taxon 193
Pathway
prl00472  D-Arginine and D-ornithine metabolism
prl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    BCB70_06945
Enzymes [BR:prl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     BCB70_06945
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: AOH45686
Position
complement(1482932..1483357)
AA seq 141 aa
MMSNPDQERVKRYDALRAELADLDDAALKERFWQLCEEVMTPVVDLARSHTTPSIERSVL
LRMGIDSVTTHAVVENVFAAGLGGKGAGHAVLRLSRRDGINLREAAARIAEDPKALDGLF
DGSPLPPAKTVTADAKEGASA
NT seq 426 nt   +upstreamnt  +downstreamnt
atgatgtccaacccggatcaggaacgcgtcaagcgctatgacgctctgcgcgccgaactc
gccgatctcgacgacgccgccctcaaggagcgcttctggcaactgtgcgaggaggtcatg
actccggtcgttgaccttgcccgcagccacaccaccccgtccattgaacggtccgtccta
ctgcgtatgggcatcgactcagtgacaacccacgccgtcgttgagaacgtcttcgccgcc
ggcctgggcggcaaaggagctggccacgctgtactgcgattgtctcgtcgtgacggcatc
aatctacgcgaggctgctgcccgcatagccgaagaccccaaagccctcgacggactattc
gacggcagtccgctgccacctgcgaagacagtgaccgccgatgccaaggaaggagcctcg
gcatga

DBGET integrated database retrieval system