KEGG   Polaribacter reichenbachii: BW723_13885Help
Entry
BW723_13885       CDS       T04692                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
prn  Polaribacter reichenbachii
Brite
KEGG Orthology (KO) [BR:prn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:prn03016]
    BW723_13885
Enzymes [BR:prn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BW723_13885
Transfer RNA biogenesis [BR:prn03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    BW723_13885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: APZ47307
UniProt: A0A1B8U1H5
Position
complement(3254707..3255411)
Genome map
AA seq 234 aa AA seqDB search
MSLDIIFEDDYLLCVSKPNNVLVHHAYHSRNVADEDSLLQIIKNETDLKVYPIHRLDRKT
SGIILLAKEKEYVSKFQELFTNNQIQKTYFGVVRGFSPDVKTIDSSVKGRDANVHKDALT
ALKTLANITLNIPVKPYDSSRYSLVQLSPKTGRMHQLRVHMNKISHPLIGDAKYGDKNHD
TMYADNFGWKNLFLHAGKLEFTHPFTSEKQSLKANFPEDWLALFSEFKWKNPLN
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagatattatttttgaagatgattatttactttgtgtaagtaaaccaaataac
gttttagtgcatcacgcttatcattctagaaatgttgctgatgaagattctttactgcaa
atcataaaaaatgaaacggatttaaaagtataccctattcatcgattagatcgtaaaaca
tcaggaattattctcttggcaaaagaaaaggaatatgtgtctaaatttcaagaattgttt
accaataaccagattcaaaaaacctattttggtgtagttcgtggtttttctccggatgta
aaaacaatagattcatctgtaaaaggtagagatgccaacgtacataaagatgccttaaca
gccttaaaaactttagcgaacatcactttaaacatcccagtaaaaccttatgattcttca
cgttatagtttagtacaattatcgcctaaaacagggagaatgcatcaattaagagttcat
atgaacaaaatcagtcacccattaattggtgatgcaaaatacggtgataaaaatcacgat
accatgtatgctgataactttggttggaaaaacttgtttttacacgcaggtaaattagaa
tttacacatccgtttacatcagaaaaacaaagtctaaaagcaaatttcccagaagattgg
cttgctttatttagtgagtttaagtggaaaaatcccttaaattaa

DBGET integrated database retrieval system