KEGG   Prevotella sp. oral taxon 299: HMPREF0669_01145Help
Entry
HMPREF0669_01145  CDS       T02809                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pro  Prevotella sp. oral taxon 299
Pathway
pro00564  Glycerophospholipid metabolism
pro01100  Metabolic pathways
pro01110  Biosynthesis of secondary metabolites
Module
pro_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HMPREF0669_01145
Enzymes [BR:pro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     HMPREF0669_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: EFC70690
UniProt: D3ICJ1
Position
unnamed:1665942..1666637
Genome map
AA seq 231 aa AA seqDB search
MIKKIKKLKKIKIHHEGTDTLIYSFIALATISILLWRFIDTKIPFGIFTTIGTIAYLIVL
NFYRCPIRYFGEEDTEGIVVAPADGKIVVIEEVEENQYFHEKRLMVSIFMNLFNVHANWF
PVDGKVKLIRHFDGNFHKAWLPKASEENEHADVLITTPEGQDILCRQIAGAMARRIVTYA
REGEDCYIDEHLGFIKLGSRVDLYLPIGSEICVKMGQKTTGNQTIIAKLKS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagataaaaaagctaaagaaaataaagatacatcatgagggaactgatact
ctcatctatagttttattgcacttgctactatttctattttactttggcgtttcattgat
actaagattccttttgggatattcactactattggaacaattgcctatctcattgtactt
aatttttatcgttgtcctattcgttattttggagaagaggacacagaaggtatcgttgta
gctcctgcagacggcaagattgttgtgatagaagaagtagaagaaaatcaatacttccat
gaaaagagactcatggtaagtatctttatgaatcttttcaatgttcatgcgaattggttc
cctgtagatggcaaggtaaagcttattcgtcacttcgatggtaacttccataaagcatgg
cttcccaaagcaagtgaggaaaatgaacatgcagatgtgttgataacaacacctgaagga
caagacattttatgccgacaaatagcaggagcaatggctcgtcgtattgtaacttatgca
cgagaaggcgaagattgctatatagatgagcacttaggctttattaaattaggctcacga
gtagacctttacctaccaattggtagtgagatttgtgtcaagatgggtcaaaaaacaact
ggaaatcaaacaataatagcaaagcttaaatcatag

DBGET integrated database retrieval system