KEGG   Prosthecochloris sp. GSB1: CHL67_08365Help
Entry
CHL67_08365       CDS       T04996                                 

Definition
(GenBank) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pros  Prosthecochloris sp. GSB1
Pathway
pros00010  Glycolysis / Gluconeogenesis
pros00053  Ascorbate and aldarate metabolism
pros00071  Fatty acid degradation
pros00280  Valine, leucine and isoleucine degradation
pros00310  Lysine degradation
pros00330  Arginine and proline metabolism
pros00340  Histidine metabolism
pros00380  Tryptophan metabolism
pros00410  beta-Alanine metabolism
pros00561  Glycerolipid metabolism
pros00620  Pyruvate metabolism
pros00625  Chloroalkane and chloroalkene degradation
pros01100  Metabolic pathways
pros01110  Biosynthesis of secondary metabolites
pros01120  Microbial metabolism in diverse environments
pros01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pros00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHL67_08365
   00053 Ascorbate and aldarate metabolism
    CHL67_08365
   00620 Pyruvate metabolism
    CHL67_08365
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHL67_08365
   00561 Glycerolipid metabolism
    CHL67_08365
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHL67_08365
   00310 Lysine degradation
    CHL67_08365
   00330 Arginine and proline metabolism
    CHL67_08365
   00340 Histidine metabolism
    CHL67_08365
   00380 Tryptophan metabolism
    CHL67_08365
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CHL67_08365
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CHL67_08365
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CHL67_08365
Enzymes [BR:pros01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CHL67_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASQ90929
UniProt: A0A222SK21
Position
complement(1761863..1763050)
Genome map
AA seq 395 aa AA seqDB search
MPLDPHKYSIALLDCLTNIKEYTIKSVCKASLYSEEDVLNLWGAAERFVQNFPVLVSQQK
EYINVLGDTCRNLWPSEVRRLPWGTILVCIPANAIIPLAIILPLALAASGNRIVFAFSQK
IREIGIQVLNKIETCLGDSLFVWEGTVRDVVDGLIEPEPHIDLLYYMGGSSQYPAIAEKC
ARNGVDLHYEGEGRTIALLDHEMSTPKLYASAQNILLSKVFCNGMMCSSPNAILVHRESF
SEFTKAYESLCEGPYKLSFLDSSLADLRNKYGTEKPKLQTDKSPCFWEVDLPTALNAEEL
FCPGILVAAYDDIDECINIIAKTRHKLQISLFAEEKSLLERMISRTGFARYCLNMNPALQ
DPCLPWGNYGSSGFSDVSNFYEKGLRKVIIEGTGQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccactcgaccctcataaatactctatagctctgcttgattgtttaactaacatcaaa
gagtacacaataaaaagcgtttgcaaagcttccttgtattccgaagaagatgtgctgaat
ttgtggggcgcagcagaaagatttgtgcaaaacttccccgtcctagtatctcaacaaaaa
gaatatattaatgttttaggagatacgtgtaggaatctatggcccagtgaagtaagacgc
ctgccatggggcactattcttgtttgcattcctgcaaatgcaattattccacttgcaatt
attttgcctttagcattggcggctagcgggaatcgtattgtatttgcgttttctcagaaa
atacgcgaaataggaattcaggttttaaacaagattgagacttgtttgggtgattctctc
tttgtttgggaaggaacagttagagacgttgttgatggattgatagagccggaacctcat
attgaccttttgtattacatgggcgggtcttctcaatatccagcaattgctgaaaagtgt
gcacgaaatggtgtcgacttgcattatgaaggggaaggccgaaccatagcgctattggac
catgaaatgtctaccccaaagctatacgcgagcgcacagaacattttgttatctaaagtt
ttttgcaatgggatgatgtgctcttctcccaatgcaatattagttcatcgcgaaagcttt
tctgagtttacgaaggcgtatgaatctctttgcgaaggcccatataagttgagcttcctc
gatagttcccttgctgatttgagaaataaatacggaacagaaaaaccaaaattacaaacc
gacaagtcgccttgcttttgggaggttgacctaccaacggctctaaatgcagaagagttg
ttttgccccggaattcttgttgccgcatacgacgatatagacgaatgcatcaatattatt
gctaagacacggcacaagttacagatttccctatttgcagaagaaaagtcgctgttagag
agaatgatttccagaactggatttgccagatactgtcttaatatgaatccggcgcttcaa
gacccgtgcttaccatgggggaactatggatcttctgggttcagtgacgtaagcaacttt
tacgagaaaggattgagaaaagtaatcattgagggtactgggcaatga

DBGET integrated database retrieval system