KEGG   Pseudomonas aeruginosa RP73: M062_00395
Entry
M062_00395        CDS       T02711                                 

Definition
(GenBank) type VI secretion system protein ImpM
  KO
K11890  type VI secretion system protein ImpM
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:prp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    M062_00395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:prp02044]
    M062_00395
Secretion system [BR:prp02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   M062_00395
SSDB
Motif
Pfam: TagF_N
Other DBs
NCBI-ProteinID: AGO38056
Structure
PDB: 
2QNU

Position
complement(91848..92528)
AA seq 226 aa
MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELGAAWLDAYLTSPLWRF
AIAPGLLGGEAVTGVVMPSIDRVGRYFPLTVACLLPANADLGGLVGGDDGWFEQVESLLL
STLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGA
SHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFPGIPG
NT seq 681 nt   +upstreamnt  +downstreamnt
ttgaacagcgtcggtttctacggcaagctggccggccgcggcgatttcgtcagccgcggc
ctgccgaacaccttcgtcgaaccctgggacgcctggctggccagcggcatgcgcgccagc
caggacgagctcggcgcggcctggctcgacgcctacctgaccagcccgctgtggcgcttc
gccatcgcccccggcctgcttggcggcgaagcggtgaccggagtggtgatgccgagcatc
gaccgggtcggtcgctatttcccgctgaccgtcgcctgcctgctaccggcgaacgccgac
ctcggcgggctggtcggcggcgacgacggctggttcgaacaggtcgagagcctgctgctc
tccaccctcgaaccggaggccgaggtcgaggccttcgagcaggcggtggcgcagctcccg
gcaccgccctgcggaccgcgcatcgaacaatcgctgatcagcggcaacctgctgcgcagc
gaagcggtgaccccggcgcagcgcctcgccgcgctggcccagcacgcctgcgacggcgcc
agccactggtggggacgcggctcggcacggatctccgccggcctgatgcgctaccagggc
ctgccgccggcgccggcgttcggacgattcctcaccggagagggcgaggtgatcccgctc
tttcccggcatacccggttaa

DBGET integrated database retrieval system