KEGG   Pseudomonas aeruginosa RP73: M062_00430
Entry
M062_00430        CDS       T02711                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:prp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    M062_00430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:prp02044]
    M062_00430
Secretion system [BR:prp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M062_00430
SSDB
Motif
Pfam: T6SS_VipA Herpes_UL69
Other DBs
NCBI-ProteinID: AGO38062
Structure
PDB: 
4UQY 4UQZ 5N8N

Position
102281..102799
AA seq 172 aa
MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPQAAVADR
KFLEIDVDNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESMDDFSPAAVARKVDSLN
KLLEARTQLANLLTYMDGKTGAEEMIMKAIKDPALLQALASAPKPKDDEPQA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgggaagcactaccagcagtcagaagttcatcgccaggaaccgggcgccacgcgtgcag
atcgagtacgacgtggagttgtacggtgccgagaagaaggtccagctgcccttcgtcatg
ggcgtcatggccgacctcgccggcaagcccgccgaaccccaggcggcggtcgccgaccgc
aagttcctggagatcgacgtggacaacttcgatgcccggctgaaggcgatgaagccgcgg
gtggccttcaacgtaccgaacgtgctgaccggcgaaggcaacctgagcctggacatcacc
ttcgagagcatggacgacttcagccccgccgcggtggcgcgcaaggtcgattcgctgaac
aagctgctcgaggcgcgtacccagctggccaacctgctgacctacatggacggcaagacc
ggcgccgaggaaatgatcatgaaggcgatcaaggacccggccctgcttcaggccctggcc
agcgcgccgaagcccaaagacgacgagccgcaggcgtaa

DBGET integrated database retrieval system