KEGG   Pseudomonas aeruginosa RP73: M062_00470
Entry
M062_00470        CDS       T02711                                 

Definition
(GenBank) type VI secretion protein ImpA
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:prp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    M062_00470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:prp02044]
    M062_00470
Secretion system [BR:prp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M062_00470
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: AGO38070
Structure
PDB: 
4UHV 6H3N 4MTK 6H3L

Position
112001..113941
AA seq 646 aa
MGLMQLTRLVQVDCPLGPDVLLLQRMEGREELGRLFAYELHLVSENPNLPLEQLLGKPMS
LSLELPGGSRRFFHGIVARCSQVAGHGQFAGYQATLRPWPWLLTRTSDCRIFQNQSVPEI
IKQVFRDLGFSDFEDALTRPYREWEYCVQYRETSFDFISRLMEQEGIYYWFRHEQKRHIL
VLSDAYGAHRSPAGYASVPYYPPTLGHRERDHFFDWQMAREVQPGSLTLNDYDFQRPGAR
LEVRSNIARPHAAADYPLYDYPGEYVQSQDGEQYARNRIEAIQAQHERVRLRGVVRGIGA
GHLFRLSGYPRDDQNREYLVVGAEYRVVQELYETGSGGAGSQFESELDCIDASQSFRLLP
QTPVPVVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGG
TPANFNEIRMEDKKGAEQLYIHAERNQDNLVENDASLSVGHDRNKSIGHDELARIGNNRT
RAVKLNDTLLVGGAKSDSVTGTYLIEAGAQIRLVCGKSVVEFNADGTINISGSAFNLYAS
GNGNIDTGGRLDLNSGGASEVDAKGKGVQGTIDGQVQAMFPPPAKG
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgggattgatgcaactgacccgcctggtccaggtggattgcccgctggggccggacgtg
ctgctgttgcagcgcatggagggacgcgaggaactgggacggctgttcgcctacgagctg
cacctggtatcggaaaatcccaacctgccgctggagcagttgctcggcaagccgatgagc
ctgtcgctggagctgcccggcggcagccggcgcttctttcacggcatcgtcgcgcgctgt
agccaggtggccgggcacggccagttcgccggctaccaggccaccctgcggccctggccg
tggctgctgacgcgcacctcggactgccgcatcttccagaaccagagcgtgccggagatc
atcaagcaggtgttccgcgacctcggcttttccgatttcgaggatgccctcacgcgcccc
taccgcgagtgggaatactgcgtgcagtaccgcgagaccagcttcgacttcatcagccgg
ctgatggaacaggaaggcatctactactggttccgccatgagcagaagcgccacatcctg
gtgctctccgacgcctacggcgcgcatcgcagcccggctggctacgccagcgtgccgtac
tacccgccgaccctcggccatcgcgagcgcgaccacttcttcgactggcagatggcacgc
gaggtccagcccggttcgctgaccctcaacgactacgacttccagcgccccggcgcgcgc
ctggaggtgcgttcgaacatcgcccggccgcacgcggcggccgactacccgctgtacgac
tatcccggcgaatacgtgcagagccaggacggcgagcagtacgcgcgcaaccgcatcgag
gcgatccaggcgcagcacgagcgcgtgcgcctgcgcggcgtagtgcgcgggatcggcgcc
gggcacctgttccgcctgagcggctatccgcgcgatgaccagaaccgcgagtacctggtg
gtcggcgccgaataccgggtggtccaggaactctacgaaaccggcagcggcggcgccggc
tcgcagttcgagagcgagctggactgcatcgacgccagccagtcgttccgtctcctgccg
cagactccggtaccggtggtgcgaggtccgcagaccgcggtggtggtcggacccaagggc
gaggagatctggaccgaccagtacggccgggtcaaggtgcacttccactgggatcgccac
gaccagtcgaacgagaacagctcctgctggattcgcgtgtcccaggcctgggccgggaag
aactggggttcgatgcagatcccgcggatcggccaggaagtgatcgtcagcttcctcgaa
ggcgacccggaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccc
tacgagctgccggcgaacgccacccagagcgggatgaagagccgttcgagcaagggcggc
acgccggccaacttcaacgagatccgcatggaggacaagaagggcgccgagcagttatac
atccacgccgagcgcaaccaggacaacctggtcgagaacgatgcctcgctgtcggtcggc
cacgaccgcaacaagagcatcggccacgacgagctggcgcgcatcggcaacaaccgcacc
cgcgcggtgaagctcaacgacaccctgctggtgggcggggcgaagagcgacagcgtcacc
ggcacctacctgatcgaggccggcgcgcagatccgcctggtctgcggcaagagcgtggtg
gagttcaacgccgacggcaccatcaatatctccggcagcgccttcaacctctacgccagc
ggcaacggcaacatcgacaccggcggccgcctcgacctcaattccggcggcgccagcgag
gtcgacgccaagggcaagggcgtgcagggcaccatcgacggccaggtacaggcgatgttt
ccgccgccggcgaagggctga

DBGET integrated database retrieval system